TBLASTN 7.6.0


Query=uc004foa
       |X_random|AK223412|NA|NA|GTPBP6|NM_012227|NP_036359|pseudoautosomal
       GTP-binding protein-like
        (262 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end...    119   8e-026
Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end...     73   8e-012
Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end...     57   4e-007

>Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end:41344372

          Length = 1273915

 Score =  119 bits (298), Expect = 8e-026
 Identities = 59/70 (84%), Positives = 62/70 (88%)
 Frame = -3

Query:    193 GKTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHGLIESF 252
              ||||||||||||  .||.|||||||||| ||| ||  ||||||||||||||||| ||.||
Sbjct: 323282 GKTTLIKALTGDDGLQPKDQLFATLDVTVHAGQLPCHMTVLYVDTIGFLSQLPHQLIDSF 323103

Query:    253 SATLEDVAHS 262
              ||||||| ||
Sbjct: 323102 SATLEDVIHS 323073

>Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end:41344372

          Length = 1273915

 Score =  73 bits (177), Expect = 8e-012
 Identities = 31/45 (68%), Positives = 42/45 (93%)
 Frame = -3

Query:     73 KKELEAAWGVEVFDRFTVVLHIFRCNARTKEARLQVALAEMPLHR 117
              .|.|| ||||.| ||...|||||||||.||||.||..|||.|| |
Sbjct: 324062 QKDLEEAWGVKVLDRYSLVLHIFRCNAKTKEAKLQISLAEIPLFR 323928

>Zv8_masked||Zv8_scaffold805 |chr6|Len:1273915|start:40070458|end:41344372

          Length = 1273915

 Score =  57 bits (137), Expect = 4e-007
 Identities = 27/46 (58%), Positives = 34/46 (73%)
 Frame = -2

Query:      4 AEWQVAEATALVHTLDGWSVVQTMVVSTKTPDRKLIFGKGNFEHLT 49
              |  |. ||  || ||  ||||  ...|||||..| |||||||. ||
Sbjct: 324852 AALQMEEAVGLVKTLHKWSVVDKLILSTKTPEKKRIFGKGNFQMLT 324715

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,102,829,613
Number of Sequences: 14546
Number of Extensions: 3102829613
Number of Successful Extensions: 107885198
Number of sequences better than 0.0: 0
TBLASTN 7.6.0