TBLASTN 7.6.0


Query=uc003mpu
       |5_h2_hap1|NM_022874|Q16637-2|Q16637-2|SMN1|NM_022874|NP_075012|survival
       of motor neuron 1, telomeric isoform b
        (262 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end...     80   7e-014
Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end...     54   3e-006
Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end...     51   3e-005

>Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end:44964508

          Length = 5388894

 Score =  80 bits (195), Expect = 7e-014
 Identities = 35/52 (67%), Positives = 41/52 (78%)
 Frame = -1

Query:      92 WKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLS 143
               |.||| | | ||||| .| ||| |.| .. |||| || ||| |||||||||.
Sbjct: 3234351 WQVGDSCYAFWSEDGNLYTATITSVDQEKGTCVVFYTDYGNEEEQNLSDLLT 3234196

>Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end:44964508

          Length = 5388894

 Score =  54 bits (129), Expect = 3e-006
 Identities = 25/25 (100%)
 Frame = -3

Query:      27 QSDDSDIWDDTALIKAYDKAVASFK 51
               |||||||||||||||||||||||||
Sbjct: 3234703 QSDDSDIWDDTALIKAYDKAVASFK 3234629

>Zv8_masked||Zv8_scaffold612 |chr5|Len:5388894|start:39575615|end:44964508

          Length = 5388894

 Score =  51 bits (121), Expect = 3e-005
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = -3

Query:     223 DDADALGSMLISWYMSGYHTGYYM 246
               .| .||||||||||||||||||||
Sbjct: 3229372 EDDEALGSMLISWYMSGYHTGYYM 3229301

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0