TBLASTN 7.6.0


Query=uc003mpo
       |5_h2_hap1|NM_022892|Q8TDZ4|Q8TDZ4_HUMAN|NAIP|NM_022892|NP_075043|NLR
       family, apoptosis inhibitory protein isoform
        (1241 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     69   7e-010
Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|e...     60   3e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     60   6e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     60   6e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     58   2e-006
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     58   2e-006
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     56   8e-006

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  69 bits (168), Expect = 7e-010
 Identities = 29/67 (43%), Positives = 38/67 (56%)
 Frame = +1

Query:     116 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 175
               || || .| .|| .|            .| || | |||| ||| |  |..||||  .| .
Sbjct: 5436892 EEARLSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGGLSGWEQGDDPWSEHAK 5437071

Query:     176 CFPNCPF 182
                . || |
Sbjct: 5437072 YYSNCFF 5437092

>Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|end:15595437

          Length = 3396750

 Score =  60 bits (145), Expect = 3e-007
 Identities = 26/69 (37%), Positives = 34/69 (49%)
 Frame = +1

Query:     116 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 175
               || || .| .|| ..             | |  | |||| | | |  | .|| |  .| |
Sbjct: 1657705 EEERLQTFHNWPSDAAVSPEELARAGFHYLGYGDTVQCFCCEGILRHWVDGDTPRGEHER 1657884

Query:     176 CFPNCPFLQ 184
                || |  ..
Sbjct: 1657885 HFPTCGLMR 1657911

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  60 bits (143), Expect = 6e-007
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -2

Query:     116 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 175
               |  |. ..  .|  .            .|||. | |||| |    . || || | . | .
Sbjct: 7163232 ELFRISTYAKFPTTAAVTERSLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQ 7163053

Query:     176 CFPNCPFLQNMKSSAEV 192
                 ||| |.|.. ..| .
Sbjct: 7163052 LSPNCSFIQSLPATANL 7163002

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  60 bits (143), Expect = 6e-007
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -3

Query:     116 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 175
               |  |. ..  .|  .            .|||. | |||| |    . || || | . | .
Sbjct: 7181000 ELFRISTYAKFPTTAAVTERSLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQ 7180821

Query:     176 CFPNCPFLQNMKSSAEV 192
                 ||| |.|.. ..| .
Sbjct: 7180820 LSPNCSFIQSLPATANL 7180770

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  58 bits (139), Expect = 2e-006
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -2

Query:     108 CNDSIFAYEELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGD 167
               |..     |. |||.|..|   .            .| |  | | |||||| |  |. ||
Sbjct: 7162782 CHNPGMRREQERLDTFQNWTL-ATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGD 7162606

Query:     168 DPLDDHTRCFPNCPFLQ 184
                 . .| | .||| |..
Sbjct: 7162605 RAVSEHQRHYPNCRFVR 7162555

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  58 bits (139), Expect = 2e-006
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -3

Query:     108 CNDSIFAYEELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGD 167
               |..     |. |||.|..|   .            .| |  | | |||||| |  |. ||
Sbjct: 7180550 CHNPGMRREQERLDTFQNWTL-ATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGD 7180374

Query:     168 DPLDDHTRCFPNCPFLQ 184
                 . .| | .||| |..
Sbjct: 7180373 RAVSEHQRHYPNCRFVR 7180323

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  56 bits (133), Expect = 8e-006
 Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 7/119 (5%)
 Frame = +1

Query:     119 RLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFP 178
               |..||. .|               ..||  | ||||||   .. |  || ||. |    |
Sbjct: 5436556 RVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCFSCSATVQNWNRGDTPLERHQLASP 5436735

Query:     179 NCPFL---QNMKSSAEV-TPDLQSRGXXXXXXXXXXXXXXXDSIAVGPIVPEMAQGEAQ 233
               .| ||     |..|  . .||                       .. |.|| |   ||.
Sbjct: 5436736 DCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTGEVVDE---SMYPVVPHMKSEEAR 5436903

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0