TBLASTN 7.6.0


Query=uc003mpn
       |5_h2_hap1|NM_004536|Q13075|BIRC1_HUMAN|NAIP|NM_004536|NP_004527|NLR
       family, apoptosis inhibitory protein isoform
        (1403 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...    114   2e-023
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     84   3e-014
Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|e...     76   9e-012
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     72   1e-010
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     72   1e-010
Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|e...     69   1e-009
Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|e...     63   6e-008
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     62   1e-007
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     62   1e-007
Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|e...     60   4e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     60   5e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     60   7e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     60   7e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     58   2e-006
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     58   2e-006
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     56   1e-005
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     52   2e-004

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  114 bits (285), Expect = 2e-023
 Identities = 67/183 (36%), Positives = 88/183 (48%), Gaps = 4/183 (2%)
 Frame = +1

Query:     162 RLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWF 221
               |. ||. .| | . ||   |. ||| |||. | ||||||   . ||  || | . |    
Sbjct: 5436556 RVNSFQRFP-YSEDISAQRLARAGFYFTGEGDRVQCFSCSATVQNWNRGDTPLERHQLAS 5436732

Query:     222 PKCEFLRSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELR 281
               | | ||         .  |||     .     |.      |.   | |        || |
Sbjct: 5436733 PDCRFLSCAHGMRN-SNSIQSPDYDEEAENREFLLR--TGEVVDESMYPVVPHMKSEEAR 5436903

Query:     282 LDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPN 341
               | .| .|| .|            .| || | |||| ||| |  |..||||  .| . . |
Sbjct: 5436904 LSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGGLSGWEQGDDPWSEHAKYYSN 5437083

Query:     342 CPF 344
               | |
Sbjct: 5437084 CFF 5437092

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  84 bits (206), Expect = 3e-014
 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +1

Query:     157 QEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKE 216
               . |||||..| |||     . |  |.|||  . |  | |||| ||| |  ||.||||| |
Sbjct: 5436886 KSEEARLSTFNNWP-ADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGGLSGWEQGDDPWSE 5437062

Query:     217 HAKWFPKCEF 226
               |||..  | |
Sbjct: 5437063 HAKYYSNCFF 5437092

>Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|end:15595437

          Length = 3396750

 Score =  76 bits (185), Expect = 9e-012
 Identities = 49/156 (31%), Positives = 71/156 (45%), Gaps = 6/156 (3%)
 Frame = +1

Query:     153 KMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDD 212
               ..  . || || .| |||     .||  |. ||| . |  |||||| | | | .| .|| 
Sbjct: 1657687 RLGMRSEEERLQTFHNWPSDA-AVSPEELARAGFHYLGYGDTVQCFCCEGILRHWVDGDT 1657863

Query:     213 PWKEHAKWFPKCEFLRSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAYCND 272
               |  || . || |  .| .           |  |   .  .    .  .. |   .||   
Sbjct: 1657864 PRGEHERHFPTCGLMRGRDVGNVPRGSSDSVDG--QLLSQLQRLTMDEQGLTGQAAY--- 1658028

Query:     273 SIFAYEELRLDSFKDWPRESXXXXXXXXXXXXFYTG 308
               |    |. |  .| .||  .            ||||
Sbjct: 1658029 SEMETEDNRRSTFHNWPTGAAVQPDTLARAGFFYTG 1658136

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  72 bits (176), Expect = 1e-010
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 2/76 (2%)
 Frame = -2

Query:     157 QEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKE 216
               . |. || .|.||   .  ..|  |..||  . |. | | |||||| ||.|| ||    |
Sbjct: 7162764 RREQERLDTFQNWT--LATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGDRAVSE 7162591

Query:     217 HAKWFPKCEFLRSKKS 232
               | . .| | |.|  ..
Sbjct: 7162590 HQRHYPNCRFVRGDRA 7162543

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  72 bits (176), Expect = 1e-010
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 2/76 (2%)
 Frame = -3

Query:     157 QEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKE 216
               . |. || .|.||   .  ..|  |..||  . |. | | |||||| ||.|| ||    |
Sbjct: 7180532 RREQERLDTFQNWT--LATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGDRAVSE 7180359

Query:     217 HAKWFPKCEFLRSKKS 232
               | . .| | |.|  ..
Sbjct: 7180358 HQRHYPNCRFVRGDRA 7180311

>Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|end:15595437

          Length = 3396750

 Score =  69 bits (166), Expect = 1e-009
 Identities = 34/91 (37%), Positives = 52/91 (57%)
 Frame = +1

Query:      47 AKMQKGYNSQMRSEAKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFG 106
               |.|.      |||| .||.||  .   ..  |.|.| |||.. |    .|||||  ||  
Sbjct: 1657666 ARMEAEVRLGMRSEEERLQTFHNWPSDAAVSPEELARAGFHYLGYGDTVQCFCCEGILRH 1657845

Query:     107 AGLTRLPIEDHKRFHPDCGFLLNKDVGNIAK 137
                     |  .|.|  | || .  .||||. .
Sbjct: 1657846 WVDGDTPRGEHERHFPTCGLMRGRDVGNVPR 1657938

>Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|end:15595437

          Length = 3396750

 Score =  63 bits (152), Expect = 6e-008
 Identities = 24/36 (66%), Positives = 28/36 (77%)
 Frame = +3

Query:     188 FTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPK 223
               |.|  | |.|| | | | ||| |||||.|||||||.
Sbjct: 1662858 FSGHGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQ 1662965

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  62 bits (150), Expect = 1e-007
 Identities = 24/38 (63%), Positives = 27/38 (71%)
 Frame = -1

Query:     186 FVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPK 223
               ||  |. | |.|| | | |  || ||||| |||||||.
Sbjct: 7162324 FVLVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR 7162211

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  62 bits (149), Expect = 1e-007
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +1

Query:      57 MRSEAKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIED 116
               |.||  || ||  .   |   |...| || |. |.   .|||||   | |      |  .
Sbjct: 5436883 MKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGGLSGWEQGDDPWSE 5437062

Query:     117 HKRFHPDCGFLLNKDVGNI 135
               | ... .| | |  .|||.
Sbjct: 5437063 HAKYYSNCFFFLGHNVGNV 5437119

>Zv8_masked||Zv8_scaffold2678 |chr23|Len:3396750|start:12198688|end:15595437

          Length = 3396750

 Score =  60 bits (145), Expect = 4e-007
 Identities = 26/69 (37%), Positives = 34/69 (49%)
 Frame = +1

Query:     278 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 337
               || || .| .|| ..             | |  | |||| | | |  | .|| |  .| |
Sbjct: 1657705 EEERLQTFHNWPSDAAVSPEELARAGFHYLGYGDTVQCFCCEGILRHWVDGDTPRGEHER 1657884

Query:     338 CFPNCPFLQ 346
                || |  ..
Sbjct: 1657885 HFPTCGLMR 1657911

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  60 bits (144), Expect = 5e-007
 Identities = 23/37 (62%), Positives = 26/37 (70%)
 Frame = -2

Query:     187 VFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPK 223
               |  |. | |.|| | | |  || ||||| |||||||.
Sbjct: 7180089 VLVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPR 7179979

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  60 bits (143), Expect = 7e-007
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -2

Query:     278 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 337
               |  |. ..  .|  .            .|||. | |||| |    . || || | . | .
Sbjct: 7163232 ELFRISTYAKFPTTAAVTERSLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQ 7163053

Query:     338 CFPNCPFLQNMKSSAEV 354
                 ||| |.|.. ..| .
Sbjct: 7163052 LSPNCSFIQSLPATANL 7163002

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  60 bits (143), Expect = 7e-007
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -3

Query:     278 EELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTR 337
               |  |. ..  .|  .            .|||. | |||| |    . || || | . | .
Sbjct: 7181000 ELFRISTYAKFPTTAAVTERSLARAGFYYTGLGDRVQCFRCNVTADNWQSGDCPAERHKQ 7180821

Query:     338 CFPNCPFLQNMKSSAEV 354
                 ||| |.|.. ..| .
Sbjct: 7180820 LSPNCSFIQSLPATANL 7180770

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  58 bits (139), Expect = 2e-006
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -2

Query:     270 CNDSIFAYEELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGD 329
               |..     |. |||.|..|   .            .| |  | | |||||| |  |. ||
Sbjct: 7162782 CHNPGMRREQERLDTFQNWTL-ATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGD 7162606

Query:     330 DPLDDHTRCFPNCPFLQ 346
                 . .| | .||| |..
Sbjct: 7162605 RAVSEHQRHYPNCRFVR 7162555

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  58 bits (139), Expect = 2e-006
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -3

Query:     270 CNDSIFAYEELRLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGD 329
               |..     |. |||.|..|   .            .| |  | | |||||| |  |. ||
Sbjct: 7180550 CHNPGMRREQERLDTFQNWTL-ATVTPAELAKAGLYYLGQGDRVACFSCGGQLGSWEPGD 7180374

Query:     330 DPLDDHTRCFPNCPFLQ 346
                 . .| | .||| |..
Sbjct: 7180373 RAVSEHQRHYPNCRFVR 7180323

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  56 bits (133), Expect = 1e-005
 Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 7/119 (5%)
 Frame = +1

Query:     281 RLDSFKDWPRESXXXXXXXXXXXXFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFP 340
               |..||. .|               ..||  | ||||||   .. |  || ||. |    |
Sbjct: 5436556 RVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCFSCSATVQNWNRGDTPLERHQLASP 5436735

Query:     341 NCPFL---QNMKSSAEV-TPDLQSRGXXXXXXXXXXXXXXXDSIAVGPIVPEMAQGEAQ 395
               .| ||     |..|  . .||                       .. |.|| |   ||.
Sbjct: 5436736 DCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTGEVVDE---SMYPVVPHMKSEEAR 5436903

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  52 bits (122), Expect = 2e-004
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 8/99 (8%)
 Frame = +1

Query:      63 RLKTFVTYEPYSSWI-PQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRFH 121
               |. .|  . |||  |  | .| |||||||    .||| ||  .        |.| |.   
Sbjct: 5436556 RVNSFQRF-PYSEDISAQRLARAGFYFTGEGDRVQCFSCSATVQNWNRGDTPLERHQLAS 5436732

Query:     122 PDCGFL------LNKDVGNIAKYDIRVKNLKSRLRGGKM 154
               ||| ||       | .      ||   .| .  || |..
Sbjct: 5436733 PDCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTGEV 5436849

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0