TBLASTN 7.6.0


Query=uc003mpj
       |5_h2_hap1|BC105980|Q13888|TF2H2_HUMAN|GTF2H2|NM_001515|NP_001506|genera
       l transcription factor IIH, polypeptide 2,
        (395 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     69   2e-010
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     69   2e-010
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     64   1e-008
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     61   5e-008
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     54   8e-006
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     52   3e-005
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     50   1e-004
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     49   3e-004
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     49   3e-004
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     47   7e-004

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  69 bits (168), Expect = 2e-010
 Identities = 27/35 (77%), Positives = 32/35 (91%)
 Frame = +2

Query:    275 HLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG 309
              ||| ..|| |.||||.|||||||| |||||||.||
Sbjct: 907154 HLDSSSEPELSLGGYYCPQCRAKYTELPVECKVCG 907258

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  69 bits (168), Expect = 2e-010
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +3

Query:    309 GLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGER 343
              |||||||||||||.||||||.|||| ||||| |||
Sbjct: 907344 GLTLVSAPHLARSFHHLFPLEAFQETPLEEYEGER 907448

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  64 bits (153), Expect = 1e-008
 Identities = 28/36 (77%), Positives = 34/36 (94%)
 Frame = +2

Query:    122 GNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLK 157
              |||.||||.|.|||| || |||||||||..|.||||
Sbjct: 902087 GNPKKHITALRKAVDSTCVGEPSLYNSLNMALQTLK 902194

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  61 bits (147), Expect = 5e-008
 Identities = 28/44 (63%), Positives = 34/44 (77%)
 Frame = +1

Query:    144 SLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIK 187
              .| |   . .   .||| |||||||.|||||||||| |||.|||
Sbjct: 903577 NLVNYPELYLFYCRHMPAHTSREVLVIFSSLTTCDPGNIYELIK 903708

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  54 bits (128), Expect = 8e-006
 Identities = 23/30 (76%), Positives = 28/30 (93%)
 Frame = +2

Query:     58 MRHLYVVVDGSRTMEDQDLKPNRLTCTLKL 87
              ||||.|..| ||.|||||||||||| |||.
Sbjct: 901667 MRHLFVIIDSSRSMEDQDLKPNRLTSTLKV 901756

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  52 bits (123), Expect = 3e-005
 Identities = 25/31 (80%), Positives = 27/31 (87%)
 Frame = +3

Query:    187 KTLKAAKIRVSVIGLSAEVRVCTVLARETGG 217
              .||   |||||||||||||||||.| |||||
Sbjct: 903789 QTLNGLKIRVSVIGLSAEVRVCTILTRETGG 903881

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  50 bits (118), Expect = 1e-004
 Identities = 23/26 (88%), Positives = 26/26 (100%)
 Frame = +2

Query:     20 EILKEDESGSLKATIEDILFKAKRKR 45
              |.||||||||||||.|||||.|||||
Sbjct: 899666 EVLKEDESGSLKATVEDILFQAKRKR 899743

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  49 bits (114), Expect = 3e-004
 Identities = 23/37 (62%), Positives = 26/37 (70%)
 Frame = +1

Query:    217 GTYHVILDESHYKELLTHHVXXXXXXXXXECSLIRMG 253
              |.|.|||||||.||||  ||         ||||||||
Sbjct: 903952 GSYNVILDESHFKELLLLHVKPPPASSSSECSLIRMG 904062

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  49 bits (114), Expect = 3e-004
 Identities = 19/19 (100%)
 Frame = +3

Query:      1 MDEEPERTKRWEGGYERTW 19
              |||||||||||||||||||
Sbjct: 898866 MDEEPERTKRWEGGYERTW 898922

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  47 bits (111), Expect = 7e-004
 Identities = 22/25 (88%), Positives = 23/25 (92%)
 Frame = +1

Query:    250 IRMGFPQHTIASLSDQDAKPSFSMA 274
              | .||||| ||||||||||||||||
Sbjct: 905299 ICLGFPQHVIASLSDQDAKPSFSMA 905373

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0