TBLASTN 7.6.0


Query=uc003mpc
       |5_h2_hap1|NM_144724|A1BQX0|A1BQX0_HUMAN|MARVELD2|NM_144724|NP_653325|MA
       RVEL domain containing 2 isoform beta
        (457 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end...    351   4e-095
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...    330   5e-089
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...    182   3e-044
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...     55   3e-006
Zv8_masked||Zv8_NA1725 |chrNA|Len:49906                                 54   1e-005
Zv8_masked||Zv8_NA542 |chrNA|Len:89846                                  52   5e-005
Zv8_masked||Zv8_NA543 |chrNA|Len:25643                                  48   5e-004
Zv8_masked||Zv8_NA543 |chrNA|Len:25643                                  47   0.001
Zv8_masked||Zv8_NA1371 |chrNA|Len:32306                                 46   0.002
Zv8_masked||Zv8_NA3312 |chrNA|Len:31022                                 45   0.003
Zv8_masked||Zv8_NA252 |chrNA|Len:5494                                   45   0.003
Zv8_masked||Zv8_NA1371 |chrNA|Len:32306                                 45   0.003
Zv8_masked||Zv8_NA6988 |chrNA|Len:2049                                  45   0.004
Zv8_masked||Zv8_NA434 |chrNA|Len:2476                                   45   0.006
Zv8_masked||Zv8_NA7014 |chrNA|Len:6526                                  45   0.006

>Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end:3167902

          Length = 362826

 Score =  351 bits (899), Expect = 4e-095
 Identities = 184/334 (55%), Positives = 218/334 (65%), Gaps = 16/334 (4%)
 Frame = -3

Query:     58 GPDFYSSDTEEPA-IAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPV--SDIRYISDGVE 114
              ||.|  | .|.    | |.||| ||.|||||| ||      .    .  |     .||| 
Sbjct: 223033 GPEFDPSGSEDNGDSAIDIKPVHRFIPDSWKNLFRSSSGSSKLKSMLGSSSKNTTTDGVR 222854

Query:    115 CSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLD-RHTQTVRTYS 173
              |||| ||. |       | .|||||| |...|||| .|.   .|  |.| |   |  |||
Sbjct: 222853 CSPPHSPSVP------GSYRDPYGGSGGSYNSRKEREAMLLGNPVESIDGRTAHTALTYS 222692

Query:    174 EKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLFGYSQP--- 230
              ||||||| ||.||||||                 |||| ||||||.|||| ||||||   
Sbjct: 222691 EKVEEYNQRYAYMKSWAGLLRILGCVELLLGAAIFACVCAYIHKDNEWYNTFGYSQPGGF 222512

Query:    231 ---XXXXXXXXXXXXXXXXXXXXPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSN 287
                                     |||||.||||||||| |||.|||||.|||.||||||.
Sbjct: 222511 YGGGYGGYGGSYGSGYGNANYSGPKTPFILVVAGLAWIVTIIMLVLGMTMYYQTILLDSS 222332

Query:    288 WWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIF 347
              ||||||| ||.|| .|..||  |||||| ||||||||.||  .|  ||| | || ||.||
Sbjct: 222331 WWPLTEFVINLALALLFLAAGCVYVNDTLRGGLCYYPVFNNGINGAFCRTEAGQTAAIIF 222152

Query:    348 LFVTMIVYLISALVCLKLWRHEAARRHREYMEQQ 381
              || ||||||. |.||||||||||||| ||   |.
Sbjct: 222151 LFFTMIVYLVGAIVCLKLWRHEAARRLRERHGQE 222050

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  330 bits (846), Expect = 5e-089
 Identities = 179/332 (53%), Positives = 216/332 (65%), Gaps = 12/332 (3%)
 Frame = +2

Query:     58 GPDFYSSDTEEPA-IAPDLKPVRRFVPDSWKNFFR------GKKKDPEWDKPVSDIRYIS 110
              ||.|| || |.    | |.||.|||.||| |||||       ||       |  |    |
Sbjct: 883844 GPEFYPSDVEDQVDDAMDIKPIRRFIPDSVKNFFRASVNRGSKKLTFPLPPPPIDGNTTS 884023

Query:    111 DGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLD-RHTQTV 169
               || |||| | | |.  .| .|  |||||| |...||||  |.   .|  |.  |  || 
Sbjct: 884024 QGVPCSPPHSRA-PSPTAP-SSYLDPYGGSGGSYTSRKE-QAMLLGEPLESVSGRSLQTA 884194

Query:    170 RTYSEKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLFGYS- 228
               |||||||||| ||.||||||                 |||| ||.|||.||.|..||| 
Sbjct: 884195 MTYSEKVEEYNQRYAYMKSWAGLLRILGCVELLLGAAVFACVCAYVHKDNEWFNMYGYSM 884374

Query:    229 QPXXXXXXXXXXXXXXXXXXXXPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNW 288
                                    | |||||||||.||| |.|||.||..||||||||||.|
Sbjct: 884375 HQVYGGASMGGMYGGYGSSYSGPLTPFVLVVAGVAWIVTVIILILGITMYYRTILLDSSW 884554

Query:    289 WPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFL 348
              ||.||  .|||| .||.||||||| || |||||||  |    || ||| | || ||.|||
Sbjct: 884555 WPITECVVNVALGLLYLAAAIVYVRDTLRGGLCYYQQFTVGPNAGFCRTEAGQNAAIIFL 884734

Query:    349 FVTMIVYLISALVCLKLWRHEAARRHREYMEQ 380
              || |..||. |.||||.|||||||  || .||
Sbjct: 884735 FVNMLLYLVGAIVCLKMWRHEAARMRRERLEQ 884830

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  182 bits (460), Expect = 3e-044
 Identities = 84/131 (64%), Positives = 103/131 (78%)
 Frame = -3

Query:     251 PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVALFILYMAAAIV 310
               | | ||||. ||.|| |.|..|||..|||||||||| ||||||  .|. . .||||| ||
Sbjct: 1842427 PMTAFVLVIVGLSWILTVILMVLGLTMYYRTILLDSKWWPLTEAFMNLVISLLYMAAGIV 1842248

Query:     311 YVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISALVCLKLWRHEA 370
               |||| ||||||.  . | || .  |||||||.|   |.|  |..|||| |||||.|||||
Sbjct: 1842247 YVNDLNRGGLCFMTVGNNPVLSSLCRVEGGQMAGTAFIFFNMLMYLISFLVCLKMWRHEA 1842068

Query:     371 ARRHREYMEQQ 381
               ||| || |  |
Sbjct: 1842067 ARRQREAMTCQ 1842035

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  55 bits (132), Expect = 3e-006
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = -3

Query:     172 YSEKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLF 225
               |.||.| | |.|||||||                  |||| ||| .|||| | .
Sbjct: 1842625 YAEKLEVYKLKYSYMKSWPGLLRLLAGLQLLFGGMVFACVCAYIQRDSEWSNYY 1842464

>Zv8_masked||Zv8_NA1725 |chrNA|Len:49906

          Length = 49906

 Score =  54 bits (127), Expect = 1e-005
 Identities = 24/30 (80%), Positives = 25/30 (83%)
 Frame = +1

Query:   428 IPPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
             .|||||||||||||||||   |  ||||||
Sbjct: 48505 MPPRPANFFVFLVEMGFHHAGQTGLDLLTS 48594

>Zv8_masked||Zv8_NA542 |chrNA|Len:89846

          Length = 89846

 Score =  52 bits (122), Expect = 5e-005
 Identities = 25/31 (80%), Positives = 26/31 (83%)
 Frame = -2

Query:  427 HIPPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
            |. || ||||||||| ||| |||| ||||||
Sbjct: 7672 HLLPRLANFFVFLVETGFHCVSQDGLDLLTS 7580

>Zv8_masked||Zv8_NA543 |chrNA|Len:25643

          Length = 25643

 Score =  48 bits (113), Expect = 5e-004
 Identities = 23/29 (79%)
 Frame = -1

Query:  429 PPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
            | |||||  |||| |||||||| | ||||
Sbjct: 7220 PRRPANFLYFLVETGFHRVSQDGLHLLTS 7134

>Zv8_masked||Zv8_NA543 |chrNA|Len:25643

          Length = 25643

 Score =  47 bits (110), Expect = 0.001
 Identities = 21/31 (67%), Positives = 22/31 (70%)
 Frame = -2

Query:   427 HIPPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
             | |  |||| .|  | ||| |||| ||||||
Sbjct: 17773 HPPQHPANFLIFSAETGFHHVSQDGLDLLTS 17681

>Zv8_masked||Zv8_NA1371 |chrNA|Len:32306

          Length = 32306

 Score =  46 bits (108), Expect = 0.002
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query:  432 PANFFVFLVEMGFHRVSQDDLDLLTS 457
            |. ||||||| |||||||| ||||||
Sbjct: 1116 PS*FFVFLVETGFHRVSQDGLDLLTS 1193

>Zv8_masked||Zv8_NA3312 |chrNA|Len:31022

          Length = 31022

 Score =  45 bits (106), Expect = 0.003
 Identities = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = -1

Query:  421 PELLSGHIP-PRPANFFVFLVEMGFHRVSQDDLDLLTS 457
            || |    |   |  | ||||| |||||||| ||||||
Sbjct: 3758 PE*LGQQAPATTPGEFVVFLVETGFHRVSQDGLDLLTS 3645

>Zv8_masked||Zv8_NA252 |chrNA|Len:5494

          Length = 5494

 Score =  45 bits (106), Expect = 0.003
 Identities = 21/22 (95%)
 Frame = -2

Query:  435 FFVFLVEMGFHRVSQDDLDLLT 456
            |||||||||||||||| |||||
Sbjct: 4851 FFVFLVEMGFHRVSQDGLDLLT 4786

>Zv8_masked||Zv8_NA1371 |chrNA|Len:32306

          Length = 32306

 Score =  45 bits (106), Expect = 0.003
 Identities = 20/30 (66%), Positives = 24/30 (80%)
 Frame = -3

Query:   428 IPPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
             .||||||||||||| ||| .    ..||||
Sbjct: 26475 LPPRPANFFVFLVETGFHHLG*VGIELLTS 26386

>Zv8_masked||Zv8_NA6988 |chrNA|Len:2049

          Length = 2049

 Score =  45 bits (105), Expect = 0.004
 Identities = 21/30 (70%), Positives = 22/30 (73%)
 Frame = +1

Query: 428 IPPRPANFFVFLVEMGFHRVSQDDLDLLTS 457
           .|      |||||||||| | |||||||||
Sbjct: 721 VPHHTQLIFVFLVEMGFHHVGQDDLDLLTS 810

>Zv8_masked||Zv8_NA434 |chrNA|Len:2476

          Length = 2476

 Score =  45 bits (104), Expect = 0.006
 Identities = 21/26 (80%)
 Frame = -3

Query: 432 PANFFVFLVEMGFHRVSQDDLDLLTS 457
           |  ||||||| |||||||| | ||||
Sbjct: 407 PGEFFVFLVETGFHRVSQDGLGLLTS 330

>Zv8_masked||Zv8_NA7014 |chrNA|Len:6526

          Length = 6526

 Score =  45 bits (104), Expect = 0.006
 Identities = 21/26 (80%)
 Frame = -2

Query:  431 RPANFFVFLVEMGFHRVSQDDLDLLT 456
            ||  ||||||| ||||| || |||||
Sbjct: 5286 RPG*FFVFLVETGFHRVGQDGLDLLT 5209

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0