TBLASTN 7.6.0


Query=uc003mpb
       |5_h2_hap1|NM_001038603|Q8N4S9|MALD2_HUMAN|MARVELD2|NM_001038603|NP_0010
       33692|MARVEL domain containing 2 isoform 1
        (558 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end...    351   5e-095
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...    330   7e-089
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...    182   4e-044
Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end...     80   2e-013
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     76   2e-012
Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end...     70   1e-010
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     69   5e-010
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...     67   2e-009
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...     55   4e-006
Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end...     51   1e-004

>Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end:3167902

          Length = 362826

 Score =  351 bits (899), Expect = 5e-095
 Identities = 184/334 (55%), Positives = 218/334 (65%), Gaps = 16/334 (4%)
 Frame = -3

Query:     58 GPDFYSSDTEEPA-IAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPV--SDIRYISDGVE 114
              ||.|  | .|.    | |.||| ||.|||||| ||      .    .  |     .||| 
Sbjct: 223033 GPEFDPSGSEDNGDSAIDIKPVHRFIPDSWKNLFRSSSGSSKLKSMLGSSSKNTTTDGVR 222854

Query:    115 CSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLD-RHTQTVRTYS 173
              |||| ||. |       | .|||||| |...|||| .|.   .|  |.| |   |  |||
Sbjct: 222853 CSPPHSPSVP------GSYRDPYGGSGGSYNSRKEREAMLLGNPVESIDGRTAHTALTYS 222692

Query:    174 EKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLFGYSQP--- 230
              ||||||| ||.||||||                 |||| ||||||.|||| ||||||   
Sbjct: 222691 EKVEEYNQRYAYMKSWAGLLRILGCVELLLGAAIFACVCAYIHKDNEWYNTFGYSQPGGF 222512

Query:    231 ---XXXXXXXXXXXXXXXXXXXXPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSN 287
                                     |||||.||||||||| |||.|||||.|||.||||||.
Sbjct: 222511 YGGGYGGYGGSYGSGYGNANYSGPKTPFILVVAGLAWIVTIIMLVLGMTMYYQTILLDSS 222332

Query:    288 WWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIF 347
              ||||||| ||.|| .|..||  |||||| ||||||||.||  .|  ||| | || ||.||
Sbjct: 222331 WWPLTEFVINLALALLFLAAGCVYVNDTLRGGLCYYPVFNNGINGAFCRTEAGQTAAIIF 222152

Query:    348 LFVTMIVYLISALVCLKLWRHEAARRHREYMEQQ 381
              || ||||||. |.||||||||||||| ||   |.
Sbjct: 222151 LFFTMIVYLVGAIVCLKLWRHEAARRLRERHGQE 222050

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  330 bits (846), Expect = 7e-089
 Identities = 179/332 (53%), Positives = 216/332 (65%), Gaps = 12/332 (3%)
 Frame = +2

Query:     58 GPDFYSSDTEEPA-IAPDLKPVRRFVPDSWKNFFR------GKKKDPEWDKPVSDIRYIS 110
              ||.|| || |.    | |.||.|||.||| |||||       ||       |  |    |
Sbjct: 883844 GPEFYPSDVEDQVDDAMDIKPIRRFIPDSVKNFFRASVNRGSKKLTFPLPPPPIDGNTTS 884023

Query:    111 DGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLD-RHTQTV 169
               || |||| | | |.  .| .|  |||||| |...||||  |.   .|  |.  |  || 
Sbjct: 884024 QGVPCSPPHSRA-PSPTAP-SSYLDPYGGSGGSYTSRKE-QAMLLGEPLESVSGRSLQTA 884194

Query:    170 RTYSEKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLFGYS- 228
               |||||||||| ||.||||||                 |||| ||.|||.||.|..||| 
Sbjct: 884195 MTYSEKVEEYNQRYAYMKSWAGLLRILGCVELLLGAAVFACVCAYVHKDNEWFNMYGYSM 884374

Query:    229 QPXXXXXXXXXXXXXXXXXXXXPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNW 288
                                    | |||||||||.||| |.|||.||..||||||||||.|
Sbjct: 884375 HQVYGGASMGGMYGGYGSSYSGPLTPFVLVVAGVAWIVTVIILILGITMYYRTILLDSSW 884554

Query:    289 WPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFL 348
              ||.||  .|||| .||.||||||| || |||||||  |    || ||| | || ||.|||
Sbjct: 884555 WPITECVVNVALGLLYLAAAIVYVRDTLRGGLCYYQQFTVGPNAGFCRTEAGQNAAIIFL 884734

Query:    349 FVTMIVYLISALVCLKLWRHEAARRHREYMEQ 380
              || |..||. |.||||.|||||||  || .||
Sbjct: 884735 FVNMLLYLVGAIVCLKMWRHEAARMRRERLEQ 884830

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  182 bits (460), Expect = 4e-044
 Identities = 84/131 (64%), Positives = 103/131 (78%)
 Frame = -3

Query:     251 PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVALFILYMAAAIV 310
               | | ||||. ||.|| |.|..|||..|||||||||| ||||||  .|. . .||||| ||
Sbjct: 1842427 PMTAFVLVIVGLSWILTVILMVLGLTMYYRTILLDSKWWPLTEAFMNLVISLLYMAAGIV 1842248

Query:     311 YVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFVTMIVYLISALVCLKLWRHEA 370
               |||| ||||||.  . | || .  |||||||.|   |.|  |..|||| |||||.|||||
Sbjct: 1842247 YVNDLNRGGLCFMTVGNNPVLSSLCRVEGGQMAGTAFIFFNMLMYLISFLVCLKMWRHEA 1842068

Query:     371 ARRHREYMEQQ 381
               ||| || |  |
Sbjct: 1842067 ARRQREAMTCQ 1842035

>Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end:3167902

          Length = 362826

 Score =  80 bits (195), Expect = 2e-013
 Identities = 35/56 (62%), Positives = 46/56 (82%)
 Frame = -2

Query:    444 AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSES 499
              .||| |.||..|..||||| ||.||||||  ||||||.||||.| .|  || .  |
Sbjct: 217691 SKYPAIRTDEQRDQYKAVFNDQYSEYKELHVEVQAVLKKFDEMDVMMQNLPQNPTS 217524

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  76 bits (186), Expect = 2e-012
 Identities = 34/56 (60%), Positives = 44/56 (78%)
 Frame = +2

Query:    445 KYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESR 500
              ||| |.||.||||||||| ||..||||| |||| . .||.|.| .|  ||    |.
Sbjct: 885548 KYPTIRTDEERERYKAVFNDQYAEYKELHAEVQVLTQKFEEMDNLMRNLPQRPSSQ 885715

>Zv8_masked||Zv8_scaffold1241 |chr10|Len:362826|start:2805077|end:3167902

          Length = 362826

 Score =  70 bits (171), Expect = 1e-010
 Identities = 32/39 (82%), Positives = 35/39 (89%), Gaps = 1/39 (2%)
 Frame = -2

Query:    519 DPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGY 557
              ||.||||||||.||||||||||||| |||||| |.  ||
Sbjct: 210341 DPSFLEKKERCEYLKNKLSHIKQRIHEYDKVMGWN-DGY 210228

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  69 bits (166), Expect = 5e-010
 Identities = 29/40 (72%), Positives = 37/40 (92%), Gaps = 1/40 (2%)
 Frame = +3

Query:    519 DPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS 558
              |||. ||.|||.||||||.||||.||||||.|.|.  |||
Sbjct: 887970 DPTYQEKRERCEYLKNKLAHIKQKIQEYDKIMDWN-DGYS 888086

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  67 bits (161), Expect = 2e-009
 Identities = 31/60 (51%), Positives = 42/60 (70%)
 Frame = -1

Query:     442 YVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQ 501
               |  ||| | . ..||.||||| ||. |||||  |. | | || ||| .||.| ..  | .
Sbjct: 1838970 YYRKYPEIHSLEDREQYKAVFNDQYQEYKELHREITATLMKFQELDTMMSQLINNKRSAE 1838791

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  55 bits (132), Expect = 4e-006
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = -3

Query:     172 YSEKVEEYNLRYSYMKSWAXXXXXXXXXXXXXXXXXFACVTAYIHKDSEWYNLF 225
               |.||.| | |.|||||||                  |||| ||| .|||| | .
Sbjct: 1842625 YAEKLEVYKLKYSYMKSWPGLLRLLAGLQLLFGGMVFACVCAYIQRDSEWSNYY 1842464

>Zv8_masked||Zv8_scaffold167 |chr2|Len:1987986|start:20408816|end:22396801

          Length = 1987986

 Score =  51 bits (120), Expect = 1e-004
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = -3

Query:     519 DPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMN 551
               || ||||||||.||| |||||| .|.....  |
Sbjct: 1838569 DPYFLEKKERCEYLKAKLSHIKMKIRDFEQKFN 1838471

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0