TBLASTN 7.6.0


Query=uc003mox
       |5_h2_hap1|NM_133340|O75943-3|O75943-3|RAD17|NM_133340|NP_579918|RAD17
       homolog isoform 3
        (505 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     70   1e-010
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     61   7e-008
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     61   7e-008
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     57   1e-006
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     56   3e-006
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     55   6e-006
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     52   5e-005

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  70 bits (170), Expect = 1e-010
 Identities = 29/48 (60%), Positives = 39/48 (81%)
 Frame = -1

Query:    262 VVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWN 309
              |.| ||| |. ||||||||| ||| ...|| .|||.|| || |. .|.
Sbjct: 871506 VIERSHMSGEFFNLYLHQNYPDFFSDVEDIAQASEYLSDADFLTAEWS 871363

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  61 bits (147), Expect = 7e-008
 Identities = 29/43 (67%), Positives = 36/43 (83%)
 Frame = -3

Query:    133 KNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNL 175
              .. |.|.|||| .|.||| | |||||||||||||||  |.| |
Sbjct: 872194 QSSGRISVPDKAALDLLCSGSSGDIRSAINSLQFSSFTGKNVL 872066

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  61 bits (147), Expect = 7e-008
 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 12/101 (11%)
 Frame = -3

Query:    410 RLPLKRHF-----GRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGE-PTQATVPE 463
              ..|||| .      ||..||| |.. |..| || .|        | .||    |||    
Sbjct: 867253 KIPLKRVYVNVFICRLRLEALGDKDPGILDADSENE-----DSCAAQSLDPGTTQANATT 867089

Query:    464 TWSLPLSQNSASELPASQPQPFSAQGDM-EENIIIEDYESD 503
                .|| ||. . || |||||| | .  . ||...||.|.||
Sbjct: 867088 ESNLPNSQDPSGELSASQPQPTSTEALLDEEDLLIEEYDSD 866966

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  57 bits (137), Expect = 1e-006
 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 1/59 (1%)
 Frame = -1

Query:    300 FADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINK 358
              || ...    .|| . || .|.||||.|||| .|  |. |   . |.||||| |  |||
Sbjct: 871227 FAVMVTFFSQSRSTMLEYGSSVATRGLMHSNSSRAQANSQ-STAGFKPLHKPHWLHINK 871054

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  56 bits (133), Expect = 3e-006
 Identities = 32/66 (48%), Positives = 35/66 (53%)
 Frame = -3

Query:    167 SSSKGENNLRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGK 226
              | .  |  |   ||| |  .   .    | |         |  |||||| ||||||||||
Sbjct: 871966 SDNSLERRLWASKKGKSSSAKPAVKAKGRSKSSKSKDMQDESPAIGGKDASLFLFRALGK 871787

Query:    227 ILYCKR 232
              ||||||
Sbjct: 871786 ILYCKR 871769

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  55 bits (130), Expect = 6e-006
 Identities = 24/44 (54%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -1

Query:     68 RKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISF 111
              |.... |||||. |.||||||| | |||| |.. .|  | || .
Sbjct: 872763 RQFIKCGRCPLVLIVSDSLSGDKNSRLLF-KDVLQELGIHNIRY 872635

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  52 bits (122), Expect = 5e-005
 Identities = 25/50 (50%), Positives = 36/50 (72%)
 Frame = -3

Query:      3 NTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDL 52
              .|.| |. |   ||  .|.|||||| ||..|.| |.    |.||||.| |
Sbjct: 874297 STDSRFNRFHGSSQTGLFQEFLLRANKYSRLRMSGETWTEDRKIILIEVL 874148

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0