TBLASTN 7.6.0


Query=uc003moo
       |5_h2_hap1|CR606803|Q16594|TAF9_HUMAN|TAF9|NM_003187|NP_003178|TAF9 RNA
       polymerase II isoform a
        (264 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_NA957 |chrNA|Len:3444                                   95   2e-018
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     95   2e-018
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     95   2e-018
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     87   4e-016
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     87   4e-016
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     61   3e-008
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     61   3e-008
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     58   2e-007
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     58   2e-007
Zv8_masked||Zv8_NA957 |chrNA|Len:3444                                   51   3e-005
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     51   3e-005
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     51   3e-005
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     51   3e-005
Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|e...     51   3e-005
Zv8_masked||Zv8_NA957 |chrNA|Len:3444                                   44   0.005

>Zv8_masked||Zv8_NA957 |chrNA|Len:3444

          Length = 3444

 Score =  95 bits (235), Expect = 2e-018
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +1

Query:   91 FLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKK 135
            ||||||||.|||||||||||.||||||||||||||||||||||||
Sbjct: 1387 FLLDIARQKNQTPLPLIKPYTGPRLPPDRYCLTAPNYRLKSLQKK 1521

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  95 bits (235), Expect = 2e-018
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = +2

Query:     91 FLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKK 135
              ||||||||.|||||||||||.||||||||||||||||||||||||
Sbjct: 967619 FLLDIARQKNQTPLPLIKPYTGPRLPPDRYCLTAPNYRLKSLQKK 967753

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  95 bits (235), Expect = 2e-018
 Identities = 43/45 (95%), Positives = 45/45 (100%)
 Frame = -2

Query:     91 FLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKK 135
              ||||||||.|||||||||||.||||||||||||||||||||||||
Sbjct: 851331 FLLDIARQKNQTPLPLIKPYTGPRLPPDRYCLTAPNYRLKSLQKK 851197

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  87 bits (214), Expect = 4e-016
 Identities = 40/52 (76%), Positives = 47/52 (90%)
 Frame = +1

Query:     39 MLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRD 90
              .| |   |||||..||||||.||||..|||||.||||||| |||||||||||
Sbjct: 967372 LLIFFSGYVTTIIEDAKIYSAHAKKSSVDADDIRLAIQCRVDQSFTSPPPRD 967527

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  87 bits (214), Expect = 4e-016
 Identities = 40/52 (76%), Positives = 47/52 (90%)
 Frame = -1

Query:     39 MLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRD 90
              .| |   |||||..||||||.||||..|||||.||||||| |||||||||||
Sbjct: 851578 LLIFFSGYVTTIIEDAKIYSAHAKKSSVDADDIRLAIQCRVDQSFTSPPPRD 851423

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  61 bits (147), Expect = 3e-008
 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 2/46 (4%)
 Frame = +2

Query:    204 PATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKRE 249
              | |  ||||||||||||||||||||||. |||...||. .|||| |
Sbjct: 972308 PTTPTVQNVLINPSLIGSKNILITTNMV-SQNSSSEST-SLKRKHE 972439

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  61 bits (147), Expect = 3e-008
 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 2/46 (4%)
 Frame = -3

Query:    204 PATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKRE 249
              | |  ||||||||||||||||||||||. |||...||. .|||| |
Sbjct: 846641 PTTPTVQNVLINPSLIGSKNILITTNMV-SQNSSSEST-SLKRKHE 846510

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  58 bits (139), Expect = 2e-007
 Identities = 31/58 (53%), Positives = 40/58 (68%)
 Frame = +2

Query:    146 PRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASI 203
              | .|  | .|      | | ||   .| ||||||.||||||||||.|.||. .||. |
Sbjct: 970412 P*ISTKSQSS*RIAIVLFTGTPSVQTVGTKVGTPVSLTGQRFTVQIPSSQTASVKSGI 970585

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  58 bits (139), Expect = 2e-007
 Identities = 31/58 (53%), Positives = 40/58 (68%)
 Frame = -2

Query:    146 PRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASI 203
              | .|  | .|      | | ||   .| ||||||.||||||||||.|.||. .||. |
Sbjct: 848538 P*ISTKSQSS*RIAIVLFTGTPSVQTVGTKVGTPVSLTGQRFTVQIPSSQTASVKSGI 848365

>Zv8_masked||Zv8_NA957 |chrNA|Len:3444

          Length = 3444

 Score =  51 bits (120), Expect = 3e-005
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = +2

Query:  137 STSAGRITVPRLSVGSVTSRPSTPTLG 163
            |.|||||||||||||.|.|||||||||
Sbjct: 2162 SSSAGRITVPRLSVGAVSSRPSTPTLG 2242

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  51 bits (120), Expect = 3e-005
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = +1

Query:    137 STSAGRITVPRLSVGSVTSRPSTPTLG 163
              |.|||||||||||||.|.|||||||||
Sbjct: 968404 SSSAGRITVPRLSVGAVSSRPSTPTLG 968484

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  51 bits (120), Expect = 3e-005
 Identities = 22/28 (78%), Positives = 26/28 (92%)
 Frame = +2

Query:     17 QMMAQILKDMGITEYEPRVINQMLEFAF 44
              ..| |||||||||||||||.|||||| .
Sbjct: 966644 KVMMQILKDMGITEYEPRVVNQMLEFTY 966727

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  51 bits (120), Expect = 3e-005
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = -1

Query:    137 STSAGRITVPRLSVGSVTSRPSTPTLG 163
              |.|||||||||||||.|.|||||||||
Sbjct: 850546 SSSAGRITVPRLSVGAVSSRPSTPTLG 850466

>Zv8_masked||Zv8_scaffold2517 |chr21|Len:2005789|start:39586452|end:41592240

          Length = 2005789

 Score =  51 bits (120), Expect = 3e-005
 Identities = 22/28 (78%), Positives = 26/28 (92%)
 Frame = -2

Query:     17 QMMAQILKDMGITEYEPRVINQMLEFAF 44
              ..| |||||||||||||||.|||||| .
Sbjct: 852306 KVMMQILKDMGITEYEPRVVNQMLEFTY 852223

>Zv8_masked||Zv8_NA957 |chrNA|Len:3444

          Length = 3444

 Score =  44 bits (101), Expect = 0.005
 Identities = 18/20 (90%), Positives = 19/20 (95%)
 Frame = +3

Query:   71 VRLAIQCRADQSFTSPPPRD 90
            .||||||| |||||||||||
Sbjct: 1236 IRLAIQCRVDQSFTSPPPRD 1295

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0