TBLASTN 7.6.0


Query=uc003mom
       |5_h2_hap1|NM_001015891|Q5F2S9|Q5F2S9_HUMAN|TAF9|NM_001015891|NP_0010158
       91|TAF9 RNA polymerase II isoform c
        (169 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...    104   1e-021
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     90   2e-017
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     58   1e-007
Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end...     42   0.006

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  104 bits (258), Expect = 1e-021
 Identities = 44/63 (69%), Positives = 55/63 (87%)
 Frame = +1

Query:    106 RGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIK 165
              |||  ||| ||.|||||| ..|||  .|||||||||||| ||.|| |..||..|||||.|
Sbjct: 880258 RGYTGKKLQDNVQCEIFQTIFEEAVEAYKEEIVHQLPSNTPEDLERNLEQIVQWIEQWMK 880437

Query:    166 DHN 168
              |.|
Sbjct: 880438 DNN 880446

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  90 bits (222), Expect = 2e-017
 Identities = 39/50 (78%), Positives = 45/50 (90%)
 Frame = +3

Query:     57 RVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETR 106
              .|||||..|| .||||.||||||||||||||||||||||   || |||.|
Sbjct: 879915 QVVDELEDQMGDGGVIIDYHGCDFFPERWFHIVFVLRTDNTNLYNRLESR 880064

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  58 bits (138), Expect = 1e-007
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query:      3 HRKPGTPGVGKTTLGKELASKSGLKYINVGDLARE 37
              |   ||||||||||||||| ..|| |.||||||.|
Sbjct: 878183 HELIGTPGVGKTTLGKELAQRTGLTYVNVGDLAQE 878287

>Zv8_masked||Zv8_scaffold590 |chr5|Len:3284637|start:23294260|end:26578896

          Length = 3284637

 Score =  42 bits (97), Expect = 0.006
 Identities = 16/20 (80%), Positives = 19/20 (95%)
 Frame = +2

Query:     39 QLYDGYDEEYDCPILDEDRV 58
              .|.||.|||| |||||||||
Sbjct: 878378 ELFDGFDEEYQCPILDEDRV 878437

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0