TBLASTN 7.6.0


Query=uc003moe |5_h2_hap1|CR600515|NA|NA|CDK7|NA|NA|Homo sapiens cDNA: FLJ22856
       fis, clone KAT01479, highly similar to HSCAKCDK Homo sapiens CAK mRNA
       for CDK-activating kinase
        (253 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1447 |chr12|Len:483363|start:4076850|end...    143   5e-033
Zv8_masked||Zv8_scaffold406 |chr4|Len:4197072|start:9705757|end:...    108   2e-022
Zv8_masked||Zv8_scaffold1365 |chr11|Len:2832366|start:20351965|e...    104   3e-021
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     85   2e-015
Zv8_masked||Zv8_scaffold1608 |chr13|Len:4656621|start:35494081|e...     81   2e-014
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     81   2e-014
Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end...     81   2e-014
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     79   1e-013
Zv8_masked||Zv8_scaffold1942 |chr16|Len:1906771|start:9444786|en...     76   7e-013
Zv8_masked||Zv8_scaffold2270 |chr19|Len:868760|start:5540751|end...     74   3e-012
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     74   3e-012
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     71   3e-011
Zv8_masked||Zv8_scaffold2458 |chr21|Len:701757|start:5229055|end...     69   1e-010
Zv8_masked||Zv8_scaffold1843 |chr15|Len:1647146|start:30467555|e...     65   2e-009
Zv8_masked||Zv8_scaffold2089 |chr17|Len:800717|start:38762614|en...     64   5e-009
Zv8_masked||Zv8_scaffold1157 |chr9|Len:7513948|start:18748577|en...     63   8e-009
Zv8_masked||Zv8_scaffold2763 |chr24|Len:3270771|start:8369493|en...     61   2e-008
Zv8_masked||Zv8_scaffold2295 |chr19|Len:742034|start:38654996|en...     61   3e-008
Zv8_masked||Zv8_scaffold2006 |chr16|Len:220884|start:50327867|en...     61   3e-008
Zv8_masked||Zv8_scaffold2203 |chr18|Len:2520989|start:38054062|e...     60   4e-008
Zv8_masked||Zv8_scaffold2905 |chr25|Len:3925297|start:13826475|e...     59   2e-007
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     59   2e-007
Zv8_masked||Zv8_scaffold2583 |chr22|Len:2426547|start:17436706|e...     57   3e-007
Zv8_masked||Zv8_NA6361 |chrNA|Len:82665                                 57   4e-007
Zv8_masked||Zv8_scaffold1391 |chr11|Len:762607|start:38258118|en...     57   4e-007
Zv8_masked||Zv8_scaffold1024 |chr8|Len:2514557|start:7737935|end...     57   6e-007
Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end...     57   6e-007
Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:...     57   6e-007
Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:...     57   6e-007
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     55   1e-006
Zv8_masked||Zv8_scaffold1118 |chr9|Len:40312|start:1480596|end:1...     55   2e-006
Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end...     55   2e-006
Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:...     54   3e-006
Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:...     54   3e-006
Zv8_masked||Zv8_scaffold329 |chr3|Len:5518937|start:33903330|end...     54   3e-006
Zv8_masked||Zv8_scaffold766 |chr6|Len:2230761|start:8740965|end:...     54   3e-006
Zv8_masked||Zv8_scaffold1959 |chr16|Len:1109489|start:24734725|e...     54   4e-006
Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end...     54   4e-006
Zv8_masked||Zv8_scaffold1478 |chr12|Len:2442963|start:23770607|e...     54   5e-006
Zv8_masked||Zv8_scaffold2933 |chr25|Len:161599|start:35550347|en...     53   6e-006
Zv8_masked||Zv8_scaffold1315 |chr11|Len:61577|start:1|end:61577         53   8e-006
Zv8_masked||Zv8_scaffold2320 |chr19|Len:184418|start:46205290|en...     52   1e-005
Zv8_masked||Zv8_scaffold2288 |chr19|Len:3730773|start:28631452|e...     52   1e-005
Zv8_masked||Zv8_scaffold785 |chr6|Len:2286557|start:22432550|end...     52   2e-005
Zv8_masked||Zv8_scaffold1259 |chr10|Len:1509981|start:10924862|e...     52   2e-005
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     52   2e-005
Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end...     52   2e-005
Zv8_masked||Zv8_scaffold563 |chr5|Len:2237670|start:8937185|end:...     51   2e-005
Zv8_masked||Zv8_scaffold1338 |chr11|Len:2242507|start:3232404|en...     50   4e-005
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     50   4e-005
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     50   4e-005
Zv8_masked||Zv8_scaffold1049 |chr8|Len:5441857|start:29342310|en...     50   4e-005
Zv8_masked||Zv8_scaffold1265 |chr10|Len:3100904|start:17469489|e...     50   5e-005
Zv8_masked||Zv8_scaffold1021 |chr8|Len:1354340|start:6130914|end...     50   7e-005
Zv8_masked||Zv8_scaffold63 |chr1|Len:2179510|start:33198447|end:...     49   9e-005
Zv8_masked||Zv8_scaffold2203 |chr18|Len:2520989|start:38054062|e...     49   1e-004
Zv8_masked||Zv8_NA1003 |chrNA|Len:15701                                 49   1e-004
Zv8_masked||Zv8_scaffold598 |chr5|Len:3584589|start:30856903|end...     49   1e-004
Zv8_masked||Zv8_scaffold1813 |chr15|Len:759591|start:5828712|end...     49   1e-004
Zv8_masked||Zv8_scaffold2364 |chr20|Len:2645833|start:5840117|en...     49   2e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     49   2e-004
Zv8_masked||Zv8_scaffold2386 |chr20|Len:9759258|start:28146312|e...     49   2e-004
Zv8_masked||Zv8_NA7663 |chrNA|Len:4101                                  49   2e-004
Zv8_masked||Zv8_NA1118 |chrNA|Len:18380                                 49   2e-004
Zv8_masked||Zv8_NA6416 |chrNA|Len:6115                                  48   2e-004
Zv8_masked||Zv8_scaffold2598 |chr22|Len:1087635|start:27020848|e...     48   3e-004
Zv8_masked||Zv8_scaffold1145 |chr9|Len:715037|start:8561843|end:...     48   3e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     48   3e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     48   3e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     48   3e-004
Zv8_masked||Zv8_scaffold1162 |chr9|Len:1264634|start:26837044|en...     48   3e-004
Zv8_masked||Zv8_scaffold336 |chr3|Len:2460176|start:41450233|end...     47   5e-004
Zv8_masked||Zv8_scaffold81 |chr1|Len:1001668|start:48365786|end:...     47   5e-004
Zv8_masked||Zv8_scaffold2386 |chr20|Len:9759258|start:28146312|e...     47   5e-004
Zv8_masked||Zv8_scaffold2774 |chr24|Len:991073|start:25370092|en...     47   6e-004
Zv8_masked||Zv8_scaffold2284 |chr19|Len:9685894|start:18455311|e...     46   8e-004
Zv8_masked||Zv8_scaffold1601 |chr13|Len:4285369|start:28593911|e...     46   8e-004
Zv8_masked||Zv8_scaffold2557 |chr22|Len:1100085|start:4025114|en...     46   0.001
Zv8_masked||Zv8_scaffold130 |chr2|Len:179988|start:2053343|end:2...     45   0.002
Zv8_masked||Zv8_scaffold795 |chr6|Len:2240914|start:32218623|end...     45   0.002
Zv8_masked||Zv8_NA7765 |chrNA|Len:2797                                  45   0.002
Zv8_masked||Zv8_scaffold3 |chr1|Len:643315|start:68412|end:711726       45   0.002
Zv8_masked||Zv8_scaffold2683 |chr23|Len:4697684|start:15638126|e...     45   0.002
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     44   0.003
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     44   0.003
Zv8_masked||Zv8_scaffold1162 |chr9|Len:1264634|start:26837044|en...     44   0.003
Zv8_masked||Zv8_scaffold1021 |chr8|Len:1354340|start:6130914|end...     44   0.004
Zv8_masked||Zv8_scaffold676 |chr5|Len:695498|start:67267509|end:...     44   0.004
Zv8_masked||Zv8_scaffold325 |chr3|Len:1160658|start:28627786|end...     44   0.005
Zv8_masked||Zv8_scaffold1168 |chr9|Len:66024|start:40094212|end:...     44   0.005
Zv8_masked||Zv8_scaffold1249 |chr10|Len:1172316|start:4662467|en...     43   0.007
Zv8_masked||Zv8_scaffold563 |chr5|Len:2237670|start:8937185|end:...     43   0.007
Zv8_masked||Zv8_scaffold1035 |chr8|Len:7043276|start:15951827|en...     43   0.007

>Zv8_masked||Zv8_scaffold1447 |chr12|Len:483363|start:4076850|end:4560212

          Length = 483363

 Score =  143 bits (360), Expect = 5e-033
 Identities = 86/222 (38%), Positives = 125/222 (56%), Gaps = 11/222 (4%)
 Frame = +2

Query:      1 METDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL 60
              ||.||  ||      ||| | . ..   |.||.|.|   ..||||||.|||..||  ||.
Sbjct: 464777 MESDLHQIIHSRQ-PLTPEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKI 464953

Query:     61 ADFGLAKS----FGSPNRAY-THQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLL 115
               |||.|.     .   .|.. |  | |||||||||.     | . .|.|.||||  |.| 
Sbjct: 464954 GDFGMARGLSAVYSEESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLG 465133

Query:    116 RVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCS--LPDYV-TFKSFPGIPLHHIFSAAG 172
              |    || . . ||  |   |||| |     . |  .  || .  |    ||  ..  | 
Sbjct: 465134 RRQMFPGKNYVHQLQLILSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAE 465313

Query:    173 DDLLDLIQGLFLFNPCARITATQALKMKYFS--NRPGPTPGC 212
                 |.|.  .  |.|  ||.| |||.  | |  . |   | |
Sbjct: 465314 PSALNLLAAMLRFDPRERISACQALEHPYLSKYHDPDDEPVC 465439

>Zv8_masked||Zv8_scaffold406 |chr4|Len:4197072|start:9705757|end:13902828

          Length = 4197072

 Score =  108 bits (269), Expect = 2e-022
 Identities = 60/142 (42%), Positives = 89/142 (62%), Gaps = 6/142 (4%)
 Frame = +2

Query:      21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENG--VLKLADFGLAKSFGSPNRAYTH 78
               .. .    || || ||.. |.| |||| |.|| . |   .|. |||   |     | ||.
Sbjct: 3356951 VRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFG--SSCYEHQRVYTY 3357124

Query:      79 QVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGT 138
                . .|.|||||.. ||| ||. .|||..||||||||   | |||. . |||  . | || 
Sbjct: 3357125 -IQSRFYRAPEVILGAR-YGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGM 3357298

Query:     139 PTEEQWPDMCSLPDYVTFKSFP 160
               |.|.         .... |  |
Sbjct: 3357299 PSEKLLESSKRAKNFISSKGHP 3357364

>Zv8_masked||Zv8_scaffold1365 |chr11|Len:2832366|start:20351965|end:23184330

          Length = 2832366

 Score =  104 bits (258), Expect = 3e-021
 Identities = 58/142 (40%), Positives = 85/142 (59%), Gaps = 6/142 (4%)
 Frame = +1

Query:      21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENG--VLKLADFGLAKSFGSPNRAYTH 78
               .. .    || || ||.| |.| |||| |.|| . |   .|. |||   |     | ||.
Sbjct: 2661874 VRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFG--SSCFDHQRVYTY 2662047

Query:      79 QVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGT 138
                . .|.|||||.. |.| ||. .|||. ||||||||   |  ||. . |||  . | || 
Sbjct: 2662048 -IQSRFYRAPEVILGSR-YGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGM 2662221

Query:     139 PTEEQWPDMCSLPDYVTFKSFP 160
               |  .         .... |  |
Sbjct: 2662222 PPSKLLEQAKRAKNFISSKGHP 2662287

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  85 bits (209), Expect = 2e-015
 Identities = 40/50 (80%), Positives = 45/50 (90%)
 Frame = +1

Query:     41 LHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPEL 90
              | .||||||||||||||||||||||||.|||||| ||||||||. .  .|
Sbjct: 181213 LSQDLKPNNLLLDENGVLKLADFGLAKAFGSPNRVYTHQVVTRFVQVSDL 181362

>Zv8_masked||Zv8_scaffold1608 |chr13|Len:4656621|start:35494081|end:40150701

          Length = 4656621

 Score =  81 bits (199), Expect = 2e-014
 Identities = 39/62 (62%), Positives = 43/62 (69%)
 Frame = -3

Query:      76 YTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFET 135
               ||  | |||||||||| |   ||  ||.|||||. ||||   |  || ||.|||  | .|
Sbjct: 1482781 YTDYVATRWYRAPELLVGDTQYGPPVDVWAVGCVFAELLSGAPLWPGKSDVDQLYLIRKT 1482602

Query:     136 LG 137
               ||
Sbjct: 1482601 LG 1482596

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  81 bits (199), Expect = 2e-014
 Identities = 36/49 (73%), Positives = 42/49 (85%)
 Frame = +2

Query:    147 MCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQ 195
              | ||||||.|| ||| || |||||||||||.|..||| .|||.| || |
Sbjct: 186200 MSSLPDYVSFKPFPGTPLEHIFSAAGDDLLELLRGLFTYNPCSRTTAMQ 186346

>Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end:2412068

          Length = 271527

 Score =  81 bits (199), Expect = 2e-014
 Identities = 35/63 (55%), Positives = 47/63 (74%)
 Frame = -1

Query:     21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQV 80
              ...|.   |||| . | | .||||||| |||..  | .||||||||..|| | | |||.|
Sbjct: 257046 VQSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEV 256867

Query:     81 VTR 83
                |
Sbjct: 256866 RAR 256858

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  79 bits (192), Expect = 1e-013
 Identities = 37/41 (90%)
 Frame = +3

Query:     80 VVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFL 120
              |  |||||||||||||||||||||||||||||||||||  |
Sbjct: 181407 VFFRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVSIL 181529

>Zv8_masked||Zv8_scaffold1942 |chr16|Len:1906771|start:9444786|end:11351556

          Length = 1906771

 Score =  76 bits (186), Expect = 7e-013
 Identities = 39/77 (50%), Positives = 50/77 (64%), Gaps = 5/77 (6%)
 Frame = +1

Query:     60 LADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV 117
              | ||  ||    | || .|   . .|.||||||.|||  |   .|.|. ||.||||||  
Sbjct: 474535 LFDFHSAKQLVRGEPNVSY---ICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQ 474705

Query:    118 PFLPGDSDLDQLTRIFE 134
              |  |||| .|||  | .
Sbjct: 474706 PIFPGDSGVDQLVEIIK 474756

>Zv8_masked||Zv8_scaffold2270 |chr19|Len:868760|start:5540751|end:6409510

          Length = 868760

 Score =  74 bits (180), Expect = 3e-012
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (4%)
 Frame = -2

Query:     70 GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQL 129
              | || .|   . .|.||||||.|||  |   .|.|. ||.||||||  |  |||| .|||
Sbjct: 233587 GEPNVSY---ICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQL 233417

Query:    130 TRIFE 134
                | .
Sbjct: 233416 VEIIK 233402

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  74 bits (180), Expect = 3e-012
 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%)
 Frame = +3

Query:    195 QALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQG 245
              ||||||||||||||||| ||||||   | |||. |  . ||||| ...|||
Sbjct: 186444 QALKMKYFSNRPGPTPGPQLPRPNSSTEALKEKENLLIGIKRKR-DSIEQG 186593

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  71 bits (172), Expect = 3e-011
 Identities = 33/48 (68%), Positives = 42/48 (87%), Gaps = 1/48 (2%)
 Frame = +2

Query:      6 EVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLD 53
              .||||| ||||||..||||.|||||||||.| |||||| ..| . . |
Sbjct: 180623 QVIIKDTSLVLTPANIKAYILMTLQGLEYMHNHWILHR-VRPISQIYD 180763

>Zv8_masked||Zv8_scaffold2458 |chr21|Len:701757|start:5229055|end:5930811

          Length = 701757

 Score =  69 bits (166), Expect = 1e-010
 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 4/58 (6%)
 Frame = -1

Query:     40 ILHRDLKPNNLLLDENGVLKLADFGLAKSF----GSPNRAYTHQVVTRWYRAPELLFG 93
              |||||.|  |.|.  .|||||||||||..|     |    ||..||| ||| |||| |
Sbjct: 428550 ILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLG 428377

>Zv8_masked||Zv8_scaffold1843 |chr15|Len:1647146|start:30467555|end:32114700

          Length = 1647146

 Score =  65 bits (156), Expect = 2e-009
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +3

Query:     57 VLKLADFGLAK-SFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLL 115
              | .. |||||.      .|  | .|||..|||||.| |.| |   .|.|.|||| |||| 
Sbjct: 354297 VFQICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLG 354476

Query:    116 RVPFLPGDSDLDQL 129
              |       | . |.
Sbjct: 354477 RRILFQAQSPIQQV 354518

>Zv8_masked||Zv8_scaffold2089 |chr17|Len:800717|start:38762614|end:39563330

          Length = 800717

 Score =  64 bits (153), Expect = 5e-009
 Identities = 37/102 (36%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = -3

Query:     24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTR 83
              .|   ..|. ||| | |.||||   ||||  .  .|.||||||     |.  .     | 
Sbjct: 422172 FMHQIVKGMLYLHTHGIMHRDLTLTNLLLTTSMNIKIADFGLATQLKLPSEKHFTMCGTP 421993

Query:     84 WYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSD 125
               | .||.   .  .|.  |.|..||.    |   |  | |.|
Sbjct: 421992 NYISPEVATRS-AHGLESDVWSLGCMFYAFLTGRP--PFDTD 421876

>Zv8_masked||Zv8_scaffold1157 |chr9|Len:7513948|start:18748577|end:26262524

          Length = 7513948

 Score =  63 bits (151), Expect = 8e-009
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 8/102 (7%)
 Frame = +1

Query:      24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK-------SFGSPNRAY 76
               |    |.|. ||| . ..||||| ||..|   ||.|| ||| |.       | ||     
Sbjct: 3838621 YSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGVVKLIDFGCARRLSCLQTSTGSKGDLL 3838800

Query:      77 THQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVP 118
                    | .. |||..     .|   |.|..|| . |.    |
Sbjct: 3838801 KSVHGTPYWMAPEVI-NETGHGRKSDIWSIGCTVFEMATGKP 3838923

>Zv8_masked||Zv8_scaffold2763 |chr24|Len:3270771|start:8369493|end:11640263

          Length = 3270771

 Score =  61 bits (147), Expect = 2e-008
 Identities = 26/54 (48%), Positives = 39/54 (72%)
 Frame = -2

Query:     85 YRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGT 138
              |||||.|  . .|   .|.||||||.|||    |  ||.|..|.. .| . |||
Sbjct: 188147 YRAPEVLLRSPVYSSPIDIWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGT 187986

>Zv8_masked||Zv8_scaffold2295 |chr19|Len:742034|start:38654996|end:39397029

          Length = 742034

 Score =  61 bits (146), Expect = 3e-008
 Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query:     25 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRW 84
              |   ||||..|| | ..|||||| |.|.   | .||||||||. . |   | |  ||. |
Sbjct: 490698 MYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIY-SFQMALT-SVVSNW 490871

>Zv8_masked||Zv8_scaffold2006 |chr16|Len:220884|start:50327867|end:50548750

          Length = 220884

 Score =  61 bits (146), Expect = 3e-008
 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +3

Query:     13 SLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKS 68
              .|.| |   . ..   |.|| |.|| .|||||||| |||. . | ||||||| . |
Sbjct: 123924 TLLLFP---QLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGESSS 124082

>Zv8_masked||Zv8_scaffold2203 |chr18|Len:2520989|start:38054062|end:40575050

          Length = 2520989

 Score =  60 bits (145), Expect = 4e-008
 Identities = 34/81 (41%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = -2

Query:      1 METDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLD-ENGVLK 59
              |||||  ...    .|.  | . .|   |.||.|.|   .||||||| || .. |. |||
Sbjct: 835309 METDLCKVLEQG--LLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLK 835136

Query:     60 LADFGLAKSFGSPNRAYTHQV 80
              . |||||.     .  |.|.|
Sbjct: 835135 IGDFGLARIM---DPHYSHKV 835082

>Zv8_masked||Zv8_scaffold2905 |chr25|Len:3925297|start:13826475|end:17751771

          Length = 3925297

 Score =  59 bits (140), Expect = 2e-007
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query:     76 YTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFE 134
              ||. . .|.||.||.. |   | . .|||..|||||||    |  ||.|...|.  | |
Sbjct: 676883 YTY-IQSRFYRSPEVILG-HPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIME 677053

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  59 bits (140), Expect = 2e-007
 Identities = 30/77 (38%), Positives = 44/77 (57%)
 Frame = -1

Query:      34 YLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFG 93
               . |.. |.|||||  |.|   || .|.|||| .    . |.|      .  | ||||   
Sbjct: 4595980 FQHENNIIHRDLKAENVLYTTNGCIKVADFGFSTKVNNRNQALDTFCGSPPYAAPELFKD 4595801

Query:      94 ARMYGVGVDMWAVGCIL 110
                   |  ||.||.| .|
Sbjct: 4595800 DSYIGPPVDVWAMGVLL 4595750

>Zv8_masked||Zv8_scaffold2583 |chr22|Len:2426547|start:17436706|end:19863252

          Length = 2426547

 Score =  57 bits (137), Expect = 3e-007
 Identities = 31/89 (34%), Positives = 46/89 (51%)
 Frame = -3

Query:      22 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVV 81
               |      .  . ||||  |.|||||  |.||  .  .|.|||| |.    |.        
Sbjct: 1106671 KTMFAQMVSAINYLHQMNIVHRDLKCENILLTADEKIKIADFGFARFVEDPSELSHTFCG 1106492

Query:      82 TRWYRAPELLFGARMYGVGVDMWAVGCIL 110
               .| |  ||.. |        |.|..| ||
Sbjct: 1106491 SRAYTPPEVITGTPYDPKKYDVWSLGVIL 1106405

>Zv8_masked||Zv8_NA6361 |chrNA|Len:82665

          Length = 82665

 Score =  57 bits (136), Expect = 4e-007
 Identities = 26/43 (60%), Positives = 32/43 (74%)
 Frame = +1

Query:    24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 66
             .|   |.|| | |.  |||||||| |||... | ||||||| |
Sbjct: 78355 FMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGEA 78483

>Zv8_masked||Zv8_scaffold1391 |chr11|Len:762607|start:38258118|end:39020724

          Length = 762607

 Score =  57 bits (136), Expect = 4e-007
 Identities = 26/43 (60%), Positives = 32/43 (74%)
 Frame = +2

Query:     24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 66
              .|   |.|| | |.  |||||||| |||... | ||||||| |
Sbjct: 134627 FMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGEA 134755

>Zv8_masked||Zv8_scaffold1024 |chr8|Len:2514557|start:7737935|end:10252491

          Length = 2514557

 Score =  57 bits (135), Expect = 6e-007
 Identities = 24/42 (57%), Positives = 32/42 (76%)
 Frame = -1

Query:     24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGL 65
              ..   |.|| | |.  .||||||| |||... | ||||||||
Sbjct: 424853 FLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGL 424728

>Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end:2412068

          Length = 271527

 Score =  57 bits (135), Expect = 6e-007
 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 3/53 (5%)
 Frame = -3

Query:    108 CILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFP 160
              | | ..  |  | ||||..||| ||| ||||| |  || . |.|||    |||
Sbjct: 256222 CFLYQITRRALF-PGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDYK--PSFP 256073

>Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:8300592

          Length = 1625789

 Score =  57 bits (135), Expect = 6e-007
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = +1

Query:     21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 64
              .. ..   |.|| | |.  .||||||| |||..| | |||||||
Sbjct: 562552 LQIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFG 562683

>Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:8300592

          Length = 1625789

 Score =  57 bits (135), Expect = 6e-007
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = -3

Query:     21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 64
              .. ..   |.|| | |.  .||||||| |||..| | |||||||
Sbjct: 250929 LQIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFG 250798

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  55 bits (132), Expect = 1e-006
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +1

Query:    117 VPFLPGDSDLDQLTRIFETLGTPTEEQWP 145
              |||| |||||||||.||| |||||.| ||
Sbjct: 183286 VPFLAGDSDLDQLTKIFEALGTPTDEIWP 183372

>Zv8_masked||Zv8_scaffold1118 |chr9|Len:40312|start:1480596|end:1520907

          Length = 40312

 Score =  55 bits (130), Expect = 2e-006
 Identities = 26/52 (50%), Positives = 35/52 (67%)
 Frame = +1

Query:    13 SLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 64
             || |.   .  ..   |.|| | |   .||||||| |||... | |||||||
Sbjct: 17296 SLSLSLHLL*IFLFQLLRGLAYCHSQKVLHRDLKPQNLLINDKGELKLADFG 17451

>Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end:2412068

          Length = 271527

 Score =  55 bits (130), Expect = 2e-006
 Identities = 22/41 (53%), Positives = 30/41 (73%)
 Frame = -2

Query:     80 VVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFL 120
              ||| ||||||.| | . |   ||.|..||| ||..  . ||
Sbjct: 256394 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVFFLYFL 256272

>Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:57849257

          Length = 112022

 Score =  54 bits (129), Expect = 3e-006
 Identities = 23/44 (52%), Positives = 31/44 (70%)
 Frame = +3

Query:    24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 67
             |    | ||||||   |.|.|.|| ||||  .| ||..| |.|.
Sbjct: 52587 YFCQLLDGLEYLHSQGIVHKDIKPGNLLLTTDGALKISDLGVAE 52718

>Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:57849257

          Length = 112022

 Score =  54 bits (129), Expect = 3e-006
 Identities = 23/44 (52%), Positives = 31/44 (70%)
 Frame = -1

Query:    24 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 67
             |    | ||||||   |.|.|.|| ||||  .| ||..| |.|.
Sbjct: 34583 YFCQLLDGLEYLHSQGIVHKDIKPGNLLLTTDGALKISDLGVAE 34452

>Zv8_masked||Zv8_scaffold329 |chr3|Len:5518937|start:33903330|end:39422266

          Length = 5518937

 Score =  54 bits (129), Expect = 3e-006
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 7/56 (12%)
 Frame = -3

Query:      25 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQV 80
               |   | ||..|| . ..||||||.|.|.   | .|.||||||       | ||...
Sbjct: 2398875 MRQLLSGLDFLHTNSVIHRDLKPDNVLVSSRGEVKIADFGLA-------RIYTYRI 2398729

>Zv8_masked||Zv8_scaffold766 |chr6|Len:2230761|start:8740965|end:10971725

          Length = 2230761

 Score =  54 bits (129), Expect = 3e-006
 Identities = 25/44 (56%), Positives = 31/44 (70%)
 Frame = -3

Query:      21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 64
               .. .|   |.|| |.|   |||||||| |||.   | |||||||
Sbjct: 2009698 LQLFMFQLLRGLSYIHGRRILHRDLKPQNLLISYLGELKLADFG 2009567

>Zv8_masked||Zv8_scaffold1959 |chr16|Len:1109489|start:24734725|end:25844213

          Length = 1109489

 Score =  54 bits (128), Expect = 4e-006
 Identities = 34/74 (45%), Positives = 40/74 (54%), Gaps = 3/74 (4%)
 Frame = -1

Query:     42 HRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVV-TRWYRAPELLFGARMYGVG 100
              |||||| |.|||  | . | |||| |  |   |  |     |  | |||.|     |   
Sbjct: 443756 HRDLKPENILLDSAGHVVLTDFGLCKE-GMSGRGTTRTFCGTPEYLAPEVLL-QEEYDRT 443583

Query:    101 VDMWAVGCILAELL 114
              || | .| .| |.|
Sbjct: 443582 VDWWGLGAVLHEML 443541

>Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end:54973441

          Length = 102366

 Score =  54 bits (128), Expect = 4e-006
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +2

Query:     8 IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL 60
             |  |||  .    .|  |.  |.|. .|| .|||||||| .||||   |.||.
Sbjct: 42017 ICADNS--VCSGEVKTLMIQLLRGVRHLHDNWILHRDLKTSNLLLSHKGILKV 42169

>Zv8_masked||Zv8_scaffold1478 |chr12|Len:2442963|start:23770607|end:26213569

          Length = 2442963

 Score =  54 bits (127), Expect = 5e-006
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = +2

Query:     22 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFG 70
              .. |   |. ..|||   |.|||||| |.|||. | |||.||| .   |
Sbjct: 575186 RSMMRALLEAVQYLHALNIVHRDLKPENILLDDQGHLKLSDFGFSVQLG 575332

>Zv8_masked||Zv8_scaffold2933 |chr25|Len:161599|start:35550347|end:35711945

          Length = 161599

 Score =  53 bits (126), Expect = 6e-006
 Identities = 26/48 (54%), Positives = 30/48 (62%)
 Frame = +2

Query:    105 AVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPD 152
              ||||| ||||   | ||| |.. ||  | . |||| |  || . |  |
Sbjct: 158225 AVGCIFAELLAHKPLLPGASEIQQLDLIVQLLGTPNESIWPVLSSDKD 158368

>Zv8_masked||Zv8_scaffold1315 |chr11|Len:61577|start:1|end:61577

          Length = 61577

 Score =  53 bits (125), Expect = 8e-006
 Identities = 24/45 (53%), Positives = 32/45 (71%)
 Frame = +3

Query:    25 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSF 69
             |   | || .|| . .||||||| |.|.   | .||||||||. .
Sbjct: 54645 MQQLLCGLAFLHTNRVLHRDLKPENILVTSRGQVKLADFGLARIY 54779

>Zv8_masked||Zv8_scaffold2320 |chr19|Len:184418|start:46205290|end:46389707

          Length = 184418

 Score =  52 bits (124), Expect = 1e-005
 Identities = 22/46 (47%), Positives = 31/46 (67%)
 Frame = +2

Query:    97 YGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 142
             |  |||||..||||||.||  |  || | ..|. .|   .  |. |
Sbjct: 22865 YTKGVDMWSIGCILAEMLLGKPLFPGTSTINQIEKIMNVIPHPSTE 23002

>Zv8_masked||Zv8_scaffold2288 |chr19|Len:3730773|start:28631452|end:32362224

          Length = 3730773

 Score =  52 bits (123), Expect = 1e-005
 Identities = 26/51 (50%), Positives = 33/51 (64%)
 Frame = +1

Query:      16 LTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 66
               ||   |   .  ||.||||||    .|||.|  |.||.  |  ||||||.|
Sbjct: 3328327 LTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVA 3328479

>Zv8_masked||Zv8_scaffold785 |chr6|Len:2286557|start:22432550|end:24719106

          Length = 2286557

 Score =  52 bits (122), Expect = 2e-005
 Identities = 22/49 (44%), Positives = 34/49 (69%)
 Frame = +2

Query:     21 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSF 69
              .  ...  ||||||||   ||| |.||.|...    |.|. ||| |. |
Sbjct: 513224 VVGFIVQILQGLEYLHNCKILHLDIKPDNIMVTNLNVIKIIDFGSAQRF 513370

>Zv8_masked||Zv8_scaffold1259 |chr10|Len:1509981|start:10924862|end:12434842

          Length = 1509981

 Score =  52 bits (122), Expect = 2e-005
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 3/85 (3%)
 Frame = -1

Query:   31 GLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPN--RAYTHQVVTRWYRAP 88
            |. || .   .||||   | |. || |.|.|||||...  . .  .|  .  .   .  |
Sbjct: 2811 GMAYLSERKFVHRDLATRNCLVAENLVVKIADFGLSRNIYAADYYKASENDAIPIRWMPP 2632

Query:   89 ELLFGARMYGVGVDMWAVGCILAEL 113
            | .|  | |    |.|| | .| |.
Sbjct: 2631 ESIFYNR-YTSESDVWAYGVVLWEI 2560

>Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|end:28024282

          Length = 10610383

 Score =  52 bits (122), Expect = 2e-005
 Identities = 22/52 (42%), Positives = 35/52 (67%)
 Frame = -1

Query:       15 VLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 66
                . .   ..  .   |. .|||| | |.|||||| |.|||..  .|| ||| .
Sbjct: 10434592 IFSSQSVRKIIRALLEVVEYLHAHNIVHRDLKPENILLDDDVNIKLTDFGFS 10434437

>Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end:54973441

          Length = 102366

 Score =  52 bits (122), Expect = 2e-005
 Identities = 22/40 (55%), Positives = 31/40 (77%)
 Frame = +1

Query:    57 VLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARM 96
             .| . |||||. .||| . ||  ||| |||.|.|| ||..
Sbjct: 43687 LL*IGDFGLAREYGSPLKPYTPVVVTLWYRSPDLLLGAKV 43806

>Zv8_masked||Zv8_scaffold563 |chr5|Len:2237670|start:8937185|end:11174854

          Length = 2237670

 Score =  51 bits (121), Expect = 2e-005
 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 2/61 (3%)
 Frame = -1

Query:       1 METDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL 60
               |||||  ..|     |.  ||  ..   |.||.|.|   .|||||||.||||.    ||.
Sbjct: 1396530 METDLYKLLKTQH--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKV 1396357

Query:      61 A 61
               .
Sbjct: 1396356 S 1396354

>Zv8_masked||Zv8_scaffold1338 |chr11|Len:2242507|start:3232404|end:5474910

          Length = 2242507

 Score =  50 bits (119), Expect = 4e-005
 Identities = 24/66 (36%), Positives = 39/66 (59%)
 Frame = -2

Query:     25 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRW 84
              .|  .  | |||.  |||||||  |. | .  ..|. | |.|.   . |   .  . | .
Sbjct: 535152 LLTFVVDL*YLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPY 534973

Query:     85 YRAPEL 90
              | .|||
Sbjct: 534972 YMSPEL 534955

>Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end:24353001

          Length = 1347008

 Score =  50 bits (119), Expect = 4e-005
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -2

Query:      1 METDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL 60
              |||||  ..|     |.  ||  ..   |.||.|.|   .|||||||.|||..    ||.
Sbjct: 483652 METDLYKLLKTQQ--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKV 483479

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0