TBLASTN 7.6.0


Query=uc003mod
       |5_h2_hap1|L20320|P50613|CDK7_HUMAN|CDK7|NM_001799|NP_001790|cyclin-depe
       ndent kinase 7
        (305 letters)

Database: Zv8_masked;
          14,546 sequences; 493,649,665 total letters
                                                                  Score    E

Zv8_masked||Zv8_scaffold1447 |chr12|Len:483363|start:4076850|end...    148   3e-034
Zv8_masked||Zv8_scaffold406 |chr4|Len:4197072|start:9705757|end:...    127   5e-028
Zv8_masked||Zv8_scaffold1365 |chr11|Len:2832366|start:20351965|e...    121   3e-026
Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|e...     88   2e-016
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     85   2e-015
Zv8_masked||Zv8_scaffold1608 |chr13|Len:4656621|start:35494081|e...     81   3e-014
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     81   3e-014
Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end...     81   3e-014
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     79   2e-013
Zv8_masked||Zv8_scaffold1942 |chr16|Len:1906771|start:9444786|en...     76   1e-012
Zv8_masked||Zv8_scaffold2270 |chr19|Len:868760|start:5540751|end...     74   5e-012
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     74   5e-012
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     71   4e-011
Zv8_masked||Zv8_scaffold1833 |chr15|Len:3463841|start:13850826|e...     70   7e-011
Zv8_masked||Zv8_scaffold2458 |chr21|Len:701757|start:5229055|end...     69   2e-010
Zv8_masked||Zv8_scaffold1843 |chr15|Len:1647146|start:30467555|e...     65   3e-009
Zv8_masked||Zv8_scaffold2203 |chr18|Len:2520989|start:38054062|e...     65   3e-009
Zv8_masked||Zv8_scaffold2089 |chr17|Len:800717|start:38762614|en...     64   7e-009
Zv8_masked||Zv8_scaffold2763 |chr24|Len:3270771|start:8369493|en...     61   3e-008
Zv8_masked||Zv8_scaffold2295 |chr19|Len:742034|start:38654996|en...     61   4e-008
Zv8_masked||Zv8_scaffold2006 |chr16|Len:220884|start:50327867|en...     61   4e-008
Zv8_masked||Zv8_scaffold2905 |chr25|Len:3925297|start:13826475|e...     59   2e-007
Zv8_masked||Zv8_NA6361 |chrNA|Len:82665                                 57   6e-007
Zv8_masked||Zv8_scaffold1391 |chr11|Len:762607|start:38258118|en...     57   6e-007
Zv8_masked||Zv8_scaffold1024 |chr8|Len:2514557|start:7737935|end...     57   8e-007
Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:...     57   8e-007
Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:...     57   8e-007
Zv8_masked||Zv8_scaffold2746 |chr24|Len:1689969|start:71649|end:...     56   1e-006
Zv8_masked||Zv8_scaffold2342 |chr20|Len:1176115|start:743444|end...     55   2e-006
Zv8_masked||Zv8_scaffold1157 |chr9|Len:7513948|start:18748577|en...     55   2e-006
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     55   2e-006
Zv8_masked||Zv8_scaffold773 |chr6|Len:307730|start:14627027|end:...     55   2e-006
Zv8_masked||Zv8_scaffold1118 |chr9|Len:40312|start:1480596|end:1...     55   3e-006
Zv8_masked||Zv8_scaffold1378 |chr11|Len:1629024|start:30219184|e...     55   3e-006
Zv8_masked||Zv8_scaffold563 |chr5|Len:2237670|start:8937185|end:...     55   3e-006
Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end...     55   3e-006
Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:...     54   4e-006
Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:...     54   4e-006
Zv8_masked||Zv8_scaffold1170 |chr9|Len:3978314|start:40506298|en...     54   4e-006
Zv8_masked||Zv8_scaffold1145 |chr9|Len:715037|start:8561843|end:...     54   4e-006
Zv8_masked||Zv8_scaffold329 |chr3|Len:5518937|start:33903330|end...     54   4e-006
Zv8_masked||Zv8_scaffold766 |chr6|Len:2230761|start:8740965|end:...     54   4e-006
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     54   5e-006
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     54   5e-006
Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end...     54   5e-006
Zv8_masked||Zv8_scaffold1478 |chr12|Len:2442963|start:23770607|e...     54   7e-006
Zv8_masked||Zv8_scaffold594 |chr5|Len:4011890|start:26583744|end...     53   9e-006
Zv8_masked||Zv8_scaffold1315 |chr11|Len:61577|start:1|end:61577         53   1e-005
Zv8_masked||Zv8_NA1118 |chrNA|Len:18380                                 53   1e-005
Zv8_masked||Zv8_scaffold2320 |chr19|Len:184418|start:46205290|en...     52   2e-005
Zv8_masked||Zv8_scaffold2288 |chr19|Len:3730773|start:28631452|e...     52   2e-005
Zv8_masked||Zv8_scaffold785 |chr6|Len:2286557|start:22432550|end...     52   3e-005
Zv8_masked||Zv8_scaffold1259 |chr10|Len:1509981|start:10924862|e...     52   3e-005
Zv8_masked||Zv8_scaffold2494 |chr21|Len:10610383|start:17413900|...     52   3e-005
Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end...     52   3e-005
Zv8_masked||Zv8_scaffold1868 |chr15|Len:238717|start:43069114|en...     51   3e-005
Zv8_masked||Zv8_scaffold2386 |chr20|Len:9759258|start:28146312|e...     51   3e-005
Zv8_masked||Zv8_NA7663 |chrNA|Len:4101                                  51   3e-005
Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end...     51   3e-005
Zv8_masked||Zv8_scaffold1338 |chr11|Len:2242507|start:3232404|en...     50   6e-005
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     50   6e-005
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     50   6e-005
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     50   6e-005
Zv8_masked||Zv8_scaffold1049 |chr8|Len:5441857|start:29342310|en...     50   6e-005
Zv8_masked||Zv8_scaffold1265 |chr10|Len:3100904|start:17469489|e...     50   7e-005
Zv8_masked||Zv8_scaffold325 |chr3|Len:1160658|start:28627786|end...     50   1e-004
Zv8_masked||Zv8_scaffold2386 |chr20|Len:9759258|start:28146312|e...     50   1e-004
Zv8_masked||Zv8_scaffold63 |chr1|Len:2179510|start:33198447|end:...     49   1e-004
Zv8_masked||Zv8_scaffold2774 |chr24|Len:991073|start:25370092|en...     49   1e-004
Zv8_masked||Zv8_scaffold1162 |chr9|Len:1264634|start:26837044|en...     49   1e-004
Zv8_masked||Zv8_NA1003 |chrNA|Len:15701                                 49   2e-004
Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:...     49   2e-004
Zv8_masked||Zv8_scaffold598 |chr5|Len:3584589|start:30856903|end...     49   2e-004
Zv8_masked||Zv8_scaffold1813 |chr15|Len:759591|start:5828712|end...     49   2e-004
Zv8_masked||Zv8_scaffold2364 |chr20|Len:2645833|start:5840117|en...     49   2e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     49   2e-004
Zv8_masked||Zv8_scaffold2598 |chr22|Len:1087635|start:27020848|e...     48   3e-004
Zv8_masked||Zv8_NA6416 |chrNA|Len:6115                                  48   3e-004
Zv8_masked||Zv8_scaffold1145 |chr9|Len:715037|start:8561843|end:...     48   4e-004
Zv8_masked||Zv8_scaffold1165 |chr9|Len:5366766|start:28891196|en...     48   4e-004
Zv8_masked||Zv8_NA7765 |chrNA|Len:2797                                  48   4e-004
Zv8_masked||Zv8_scaffold336 |chr3|Len:2460176|start:41450233|end...     47   6e-004
Zv8_masked||Zv8_scaffold174 |chr2|Len:2451912|start:23872242|end...     47   6e-004
Zv8_masked||Zv8_scaffold81 |chr1|Len:1001668|start:48365786|end:...     47   6e-004
Zv8_masked||Zv8_scaffold2691 |chr23|Len:4247924|start:29500885|e...     47   6e-004
Zv8_masked||Zv8_scaffold2284 |chr19|Len:9685894|start:18455311|e...     46   0.001
Zv8_masked||Zv8_scaffold1601 |chr13|Len:4285369|start:28593911|e...     46   0.001
Zv8_masked||Zv8_scaffold2557 |chr22|Len:1100085|start:4025114|en...     46   0.001
Zv8_masked||Zv8_scaffold130 |chr2|Len:179988|start:2053343|end:2...     45   0.002
Zv8_masked||Zv8_scaffold795 |chr6|Len:2240914|start:32218623|end...     45   0.002
Zv8_masked||Zv8_scaffold3 |chr1|Len:643315|start:68412|end:711726       45   0.003
Zv8_masked||Zv8_scaffold2683 |chr23|Len:4697684|start:15638126|e...     45   0.003
Zv8_masked||Zv8_scaffold1843 |chr15|Len:1647146|start:30467555|e...     44   0.004
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     44   0.004
Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end...     44   0.004
Zv8_masked||Zv8_scaffold2774 |chr24|Len:991073|start:25370092|en...     44   0.004
Zv8_masked||Zv8_scaffold633 |chr5|Len:968823|start:54422822|end:...     44   0.004
Zv8_masked||Zv8_scaffold1162 |chr9|Len:1264634|start:26837044|en...     44   0.004
Zv8_masked||Zv8_scaffold1021 |chr8|Len:1354340|start:6130914|end...     44   0.005
Zv8_masked||Zv8_scaffold676 |chr5|Len:695498|start:67267509|end:...     44   0.005

>Zv8_masked||Zv8_scaffold1447 |chr12|Len:483363|start:4076850|end:4560212

          Length = 483363

 Score =  148 bits (371), Expect = 3e-034
 Identities = 88/227 (38%), Positives = 128/227 (56%), Gaps = 11/227 (4%)
 Frame = +2

Query:     48 LVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDEN 107
              .| | ||.||  ||      ||| | . ..   |.||.|.|   ..||||||.|||..||
Sbjct: 464762 VVLDLMESDLHQIIHSRQ-PLTPEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNEN 464938

Query:    108 GVLKLADFGLAKS----FGSPNRAY-THQVVTRWYRAPELLFGARMYGVGVDMWAVGCIL 162
                ||. |||.|.     .   .|.. |  | |||||||||.     | . .|.|.|||| 
Sbjct: 464939 CELKIGDFGMARGLSAVYSEESRSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIF 465118

Query:    163 AELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCS--LPDYV-TFKSFPGIPLHHI 219
               |.| |    || . . ||  |   |||| |     . |  .  || .  |    ||  .
Sbjct: 465119 GEMLGRRQMFPGKNYVHQLQLILSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAAL 465298

Query:    220 FSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFS--NRPGPTPGC 264
              .  |    |.|.  .  |.|  ||.| |||.  | |  . |   | |
Sbjct: 465299 YPQAEPSALNLLAAMLRFDPRERISACQALEHPYLSKYHDPDDEPVC 465439

>Zv8_masked||Zv8_scaffold406 |chr4|Len:4197072|start:9705757|end:13902828

          Length = 4197072

 Score =  127 bits (318), Expect = 5e-028
 Identities = 77/207 (37%), Positives = 122/207 (58%), Gaps = 13/207 (6%)
 Frame = +2

Query:      15 NRTALREIKLLQEL------SHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLV- 67
               .| |  ||..|. |      |  |.| .|. |  ...| . |. .  .|  .|| |    
Sbjct: 3356756 HRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQG 3356935

Query:      68 LTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENG--VLKLADFGLAKSFGSPN 125
                .   .. .    || || ||.. |.| |||| |.|| . |   .|. |||   |     
Sbjct: 3356936 FSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFG--SSCYEHQ 3357109

Query:     126 RAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIF 185
               | ||. . .|.|||||.. ||| ||. .|||..||||||||   | |||. . |||  . 
Sbjct: 3357110 RVYTY-IQSRFYRAPEVILGAR-YGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVI 3357283

Query:     186 ETLGTPTEEQWPDMCSLPDYVTFKSFP 212
               | || |.|.         .... |  |
Sbjct: 3357284 EMLGMPSEKLLESSKRAKNFISSKGHP 3357364

>Zv8_masked||Zv8_scaffold1365 |chr11|Len:2832366|start:20351965|end:23184330

          Length = 2832366

 Score =  121 bits (303), Expect = 3e-026
 Identities = 73/207 (35%), Positives = 117/207 (56%), Gaps = 13/207 (6%)
 Frame = +1

Query:      15 NRTALREIKLLQELSHP------NIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLV- 67
               .| |  ||..|. |         |.. .|. |  ...| . |. .  .|  .|| |    
Sbjct: 2661679 HRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQG 2661858

Query:      68 LTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENG--VLKLADFGLAKSFGSPN 125
                .   .. .    || || ||.| |.| |||| |.|| . |   .|. |||   |     
Sbjct: 2661859 FSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFG--SSCFDHQ 2662032

Query:     126 RAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIF 185
               | ||. . .|.|||||.. |.| ||. .|||. ||||||||   |  ||. . |||  . 
Sbjct: 2662033 RVYTY-IQSRFYRAPEVILGSR-YGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMM 2662206

Query:     186 ETLGTPTEEQWPDMCSLPDYVTFKSFP 212
               | || |  .         .... |  |
Sbjct: 2662207 ELLGMPPSKLLEQAKRAKNFISSKGHP 2662287

>Zv8_masked||Zv8_scaffold1725 |chr14|Len:5609636|start:24370307|end:29979942

          Length = 5609636

 Score =  88 bits (217), Expect = 2e-016
 Identities = 59/168 (35%), Positives = 87/168 (51%), Gaps = 6/168 (3%)
 Frame = -2

Query:       8 SEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSN--ISLVFDFME-TDLEVIIKDN 64
               |  |       |.|  .|. | ||.||  .| |   .|  | .| |. .   |.  ||. 
Sbjct: 5390152 SSRKTKTKDVVLQEAIVLRSLKHPHIITWIDTFFDATNESIYIVMDYCDGGTLDDHIKEQ 5389973

Query:      65 SL--VLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFG 122
                     | |.|  . .  .  . |.|   |||||.||.|.|| . ||.|| |||..|   
Sbjct: 5389972 KCGEHFTESNIMDWFVQVVMAVSYIHSEKILHRDIKPSNVLLTKRGVIKLGDFGISKIMN 5389793

Query:     123 SPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVP 170
                     .  | |  | .|||      |    |.|||||.| ||    |
Sbjct: 5389792 HTLDMASTCVGTPSYLSPELCQDV-PYSTKSDIWAVGCLLYELCALKP 5389652

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  85 bits (209), Expect = 2e-015
 Identities = 40/50 (80%), Positives = 45/50 (90%)
 Frame = +1

Query:     93 LHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPEL 142
              | .||||||||||||||||||||||||.|||||| ||||||||. .  .|
Sbjct: 181213 LSQDLKPNNLLLDENGVLKLADFGLAKAFGSPNRVYTHQVVTRFVQVSDL 181362

>Zv8_masked||Zv8_scaffold1608 |chr13|Len:4656621|start:35494081|end:40150701

          Length = 4656621

 Score =  81 bits (199), Expect = 3e-014
 Identities = 39/62 (62%), Positives = 43/62 (69%)
 Frame = -3

Query:     128 YTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFET 187
               ||  | |||||||||| |   ||  ||.|||||. ||||   |  || ||.|||  | .|
Sbjct: 1482781 YTDYVATRWYRAPELLVGDTQYGPPVDVWAVGCVFAELLSGAPLWPGKSDVDQLYLIRKT 1482602

Query:     188 LG 189
               ||
Sbjct: 1482601 LG 1482596

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  81 bits (199), Expect = 3e-014
 Identities = 36/49 (73%), Positives = 42/49 (85%)
 Frame = +2

Query:    199 MCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQ 247
              | ||||||.|| ||| || |||||||||||.|..||| .|||.| || |
Sbjct: 186200 MSSLPDYVSFKPFPGTPLEHIFSAAGDDLLELLRGLFTYNPCSRTTAMQ 186346

>Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end:2412068

          Length = 271527

 Score =  81 bits (199), Expect = 3e-014
 Identities = 35/63 (55%), Positives = 47/63 (74%)
 Frame = -1

Query:     73 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQV 132
              ...|.   |||| . | | .||||||| |||..  | .||||||||..|| | | |||.|
Sbjct: 257046 VQSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEV 256867

Query:    133 VTR 135
                |
Sbjct: 256866 RAR 256858

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  79 bits (192), Expect = 2e-013
 Identities = 37/41 (90%)
 Frame = +3

Query:    132 VVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFL 172
              |  |||||||||||||||||||||||||||||||||||  |
Sbjct: 181407 VFFRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVSIL 181529

>Zv8_masked||Zv8_scaffold1942 |chr16|Len:1906771|start:9444786|end:11351556

          Length = 1906771

 Score =  76 bits (186), Expect = 1e-012
 Identities = 39/77 (50%), Positives = 50/77 (64%), Gaps = 5/77 (6%)
 Frame = +1

Query:    112 LADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV 169
              | ||  ||    | || .|   . .|.||||||.|||  |   .|.|. ||.||||||  
Sbjct: 474535 LFDFHSAKQLVRGEPNVSY---ICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQ 474705

Query:    170 PFLPGDSDLDQLTRIFE 186
              |  |||| .|||  | .
Sbjct: 474706 PIFPGDSGVDQLVEIIK 474756

>Zv8_masked||Zv8_scaffold2270 |chr19|Len:868760|start:5540751|end:6409510

          Length = 868760

 Score =  74 bits (180), Expect = 5e-012
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (4%)
 Frame = -2

Query:    122 GSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQL 181
              | || .|   . .|.||||||.|||  |   .|.|. ||.||||||  |  |||| .|||
Sbjct: 233587 GEPNVSY---ICSRYYRAPELIFGATDYTSNIDIWSAGCVLAELLLGQPIFPGDSGVDQL 233417

Query:    182 TRIFE 186
                | .
Sbjct: 233416 VEIIK 233402

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  74 bits (180), Expect = 5e-012
 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%)
 Frame = +3

Query:    247 QALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQG 297
              ||||||||||||||||| ||||||   | |||. |  . ||||| ...|||
Sbjct: 186444 QALKMKYFSNRPGPTPGPQLPRPNSSTEALKEKENLLIGIKRKR-DSIEQG 186593

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  71 bits (172), Expect = 4e-011
 Identities = 33/48 (68%), Positives = 42/48 (87%), Gaps = 1/48 (2%)
 Frame = +2

Query:     58 EVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLD 105
              .||||| ||||||..||||.|||||||||.| |||||| ..| . . |
Sbjct: 180623 QVIIKDTSLVLTPANIKAYILMTLQGLEYMHNHWILHR-VRPISQIYD 180763

>Zv8_masked||Zv8_scaffold1833 |chr15|Len:3463841|start:13850826|end:17314666

          Length = 3463841

 Score =  70 bits (170), Expect = 7e-011
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 6/138 (4%)
 Frame = -3

Query:      43 KSNI-SLVFDFM-ETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPN 100
               | || ..| .|    .|. .|   . .|       | .   . |..|| | ..| |||| 
Sbjct: 1932918 KDNIGTIVMEFAGNINLQKLIYGLTDLLPVEKCIKYSIDIARALQHLHAHGVVHLDLKPA 1932739

Query:     101 NLLLDENGVLKLADFGLAKSFGSPNRAYTHQVV---TRWYRAPELLFGARMYGVGVDMWA 157
               |.|| | || |.|||| .    | .   ||      |  .|||||| |  .    ||...
Sbjct: 1932738 NVLLSEQGVCKIADFGCSFKISSTSDTVTHMNEIGGTFTHRAPELLKGEEV-SPRVDVYS 1932562

Query:     158 VGCILAELLLRVPFLPGD 175
                |  . .|| | |   ||
Sbjct: 1932561 FGITMWQLLTREPPYEGD 1932508

>Zv8_masked||Zv8_scaffold2458 |chr21|Len:701757|start:5229055|end:5930811

          Length = 701757

 Score =  69 bits (166), Expect = 2e-010
 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 4/58 (6%)
 Frame = -1

Query:     92 ILHRDLKPNNLLLDENGVLKLADFGLAKSF----GSPNRAYTHQVVTRWYRAPELLFG 145
              |||||.|  |.|.  .|||||||||||..|     |    ||..||| ||| |||| |
Sbjct: 428550 ILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLG 428377

>Zv8_masked||Zv8_scaffold1843 |chr15|Len:1647146|start:30467555|end:32114700

          Length = 1647146

 Score =  65 bits (156), Expect = 3e-009
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +3

Query:    109 VLKLADFGLAK-SFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLL 167
              | .. |||||.      .|  | .|||..|||||.| |.| |   .|.|.|||| |||| 
Sbjct: 354297 VFQICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLG 354476

Query:    168 RVPFLPGDSDLDQL 181
              |       | . |.
Sbjct: 354477 RRILFQAQSPIQQV 354518

>Zv8_masked||Zv8_scaffold2203 |chr18|Len:2520989|start:38054062|end:40575050

          Length = 2520989

 Score =  65 bits (156), Expect = 3e-009
 Identities = 35/90 (38%), Positives = 60/90 (66%), Gaps = 6/90 (6%)
 Frame = -2

Query:     44 SNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLL 103
              ... .| ..|||||  ...    .|.  | . .|   |.||.|.|   .||||||| || 
Sbjct: 835336 NSVYIVQEYMETDLCKVLEQG--LLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLF 835163

Query:    104 LD-ENGVLKLADFGLAKSFGSPNRAYTHQV 132
              .. |. |||. |||||.     .  |.|.|
Sbjct: 835162 VNTEDLVLKIGDFGLARIM---DPHYSHKV 835082

>Zv8_masked||Zv8_scaffold2089 |chr17|Len:800717|start:38762614|end:39563330

          Length = 800717

 Score =  64 bits (153), Expect = 7e-009
 Identities = 37/102 (36%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = -3

Query:     76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTR 135
              .|   ..|. ||| | |.||||   ||||  .  .|.||||||     |.  .     | 
Sbjct: 422172 FMHQIVKGMLYLHTHGIMHRDLTLTNLLLTTSMNIKIADFGLATQLKLPSEKHFTMCGTP 421993

Query:    136 WYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSD 177
               | .||.   .  .|.  |.|..||.    |   |  | |.|
Sbjct: 421992 NYISPEVATRS-AHGLESDVWSLGCMFYAFLTGRP--PFDTD 421876

>Zv8_masked||Zv8_scaffold2763 |chr24|Len:3270771|start:8369493|end:11640263

          Length = 3270771

 Score =  61 bits (147), Expect = 3e-008
 Identities = 26/54 (48%), Positives = 39/54 (72%)
 Frame = -2

Query:    137 YRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGT 190
              |||||.|  . .|   .|.||||||.|||    |  ||.|..|.. .| . |||
Sbjct: 188147 YRAPEVLLRSPVYSSPIDIWAVGCIMAELYTLRPLFPGNSEVDEIFKICQVLGT 187986

>Zv8_masked||Zv8_scaffold2295 |chr19|Len:742034|start:38654996|end:39397029

          Length = 742034

 Score =  61 bits (146), Expect = 4e-008
 Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query:     77 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRW 136
              |   ||||..|| | ..|||||| |.|.   | .||||||||. . |   | |  ||. |
Sbjct: 490698 MYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIY-SFQMALT-SVVSNW 490871

>Zv8_masked||Zv8_scaffold2006 |chr16|Len:220884|start:50327867|end:50548750

          Length = 220884

 Score =  61 bits (146), Expect = 4e-008
 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +3

Query:     65 SLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKS 120
              .|.| |   . ..   |.|| |.|| .|||||||| |||. . | ||||||| . |
Sbjct: 123924 TLLLFP---QLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGESSS 124082

>Zv8_masked||Zv8_scaffold2905 |chr25|Len:3925297|start:13826475|end:17751771

          Length = 3925297

 Score =  59 bits (140), Expect = 2e-007
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query:    128 YTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFE 186
              ||. . .|.||.||.. |   | . .|||..|||||||    |  ||.|...|.  | |
Sbjct: 676883 YTY-IQSRFYRSPEVILG-HPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIME 677053

>Zv8_masked||Zv8_NA6361 |chrNA|Len:82665

          Length = 82665

 Score =  57 bits (136), Expect = 6e-007
 Identities = 26/43 (60%), Positives = 32/43 (74%)
 Frame = +1

Query:    76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 118
             .|   |.|| | |.  |||||||| |||... | ||||||| |
Sbjct: 78355 FMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGEA 78483

>Zv8_masked||Zv8_scaffold1391 |chr11|Len:762607|start:38258118|end:39020724

          Length = 762607

 Score =  57 bits (136), Expect = 6e-007
 Identities = 26/43 (60%), Positives = 32/43 (74%)
 Frame = +2

Query:     76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLA 118
              .|   |.|| | |.  |||||||| |||... | ||||||| |
Sbjct: 134627 FMFQLLRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGEA 134755

>Zv8_masked||Zv8_scaffold1024 |chr8|Len:2514557|start:7737935|end:10252491

          Length = 2514557

 Score =  57 bits (135), Expect = 8e-007
 Identities = 24/42 (57%), Positives = 32/42 (76%)
 Frame = -1

Query:     76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGL 117
              ..   |.|| | |.  .||||||| |||... | ||||||||
Sbjct: 424853 FLFQLLRGLNYCHRRKVLHRDLKPQNLLINDRGELKLADFGL 424728

>Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:8300592

          Length = 1625789

 Score =  57 bits (135), Expect = 8e-007
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = +1

Query:     73 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 116
              .. ..   |.|| | |.  .||||||| |||..| | |||||||
Sbjct: 562552 LQIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFG 562683

>Zv8_masked||Zv8_scaffold401 |chr4|Len:1625789|start:6674804|end:8300592

          Length = 1625789

 Score =  57 bits (135), Expect = 8e-007
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = -3

Query:     73 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 116
              .. ..   |.|| | |.  .||||||| |||..| | |||||||
Sbjct: 250929 LQIFLFQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFG 250798

>Zv8_masked||Zv8_scaffold2746 |chr24|Len:1689969|start:71649|end:1761617

          Length = 1689969

 Score =  56 bits (134), Expect = 1e-006
 Identities = 26/66 (39%), Positives = 42/66 (63%)
 Frame = -3

Query:     40 FGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP 99
              ||      |||..|. ||  ...   .    ||||..|   |.||.| |.   ||||.| 
Sbjct: 822823 FGLSGAFYLVFEYMDHDLMGLLESGLVHFNESHIKSFMRQLLEGLDYCHKKNFLHRDIKC 822644

Query:    100 NNLLLD 105
              .|.||.
Sbjct: 822643 SNILLN 822626

>Zv8_masked||Zv8_scaffold2342 |chr20|Len:1176115|start:743444|end:1919558

          Length = 1176115

 Score =  55 bits (132), Expect = 2e-006
 Identities = 35/135 (25%), Positives = 68/135 (50%), Gaps = 11/135 (8%)
 Frame = -1

Query:     11 KDGINRTALREIK----LLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSL 66
              || . |  .  .|    .| |  .  .. |  .|  | |.  | |..     . .     
Sbjct: 575341 KDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMG 575162

Query:     67 VLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNR 126
              .      . |.   .  .| .|.   .|||.||.|.|.| .| .|| ||||   |     
Sbjct: 575161 IFQEDLAQFYIAELICAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGF----- 574997

Query:    127 AYTHQVVTRWYRAPE 141
               .||   ...|.. |
Sbjct: 574996 RWTHD--SKYYQSGE 574958

>Zv8_masked||Zv8_scaffold1157 |chr9|Len:7513948|start:18748577|end:26262524

          Length = 7513948

 Score =  55 bits (132), Expect = 2e-006
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +3

Query:      11 KDGINRTALREIK----LLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSL 66
               || .||  .  .|    .| |  .  .. |  .|  . |.  | |..     . .     
Sbjct: 1902660 KDVLNRNQVAHVKAERDILAEADNEWVVRLYYSFQDRDNLYFVMDYIPGGDMMSLLIRMG 1902839

Query:      67 VLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSF 121
               |      . |.      .| .|.   .|||.||.|.|.| .| .|| ||||   |
Sbjct: 1902840 VFPEVLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGF 1903004

>Zv8_masked||Zv8_scaffold625 |chr5|Len:323553|start:52866528|end:53190080

          Length = 323553

 Score =  55 bits (132), Expect = 2e-006
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = +1

Query:    169 VPFLPGDSDLDQLTRIFETLGTPTEEQWP 197
              |||| |||||||||.||| |||||.| ||
Sbjct: 183286 VPFLAGDSDLDQLTKIFEALGTPTDEIWP 183372

>Zv8_masked||Zv8_scaffold773 |chr6|Len:307730|start:14627027|end:14934756

          Length = 307730

 Score =  55 bits (131), Expect = 2e-006
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%)
 Frame = +1

Query:     61 IKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLL-LDENG-VLKLADFGLA 118
              | |    ||   .  |||  . |....|.  |.| |||| |.. ... |  .|| |||||
Sbjct: 252790 IVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLA 252969

Query:    119 KSFGSPNRAYTHQVVTRWYR 138
              .  |   |  |  .|  |.|
Sbjct: 252970 RRLGKETRKQTWCLVF-WHR 253026

>Zv8_masked||Zv8_scaffold1118 |chr9|Len:40312|start:1480596|end:1520907

          Length = 40312

 Score =  55 bits (130), Expect = 3e-006
 Identities = 26/52 (50%), Positives = 35/52 (67%)
 Frame = +1

Query:    65 SLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 116
             || |.   .  ..   |.|| | |   .||||||| |||... | |||||||
Sbjct: 17296 SLSLSLHLL*IFLFQLLRGLAYCHSQKVLHRDLKPQNLLINDKGELKLADFG 17451

>Zv8_masked||Zv8_scaffold1378 |chr11|Len:1629024|start:30219184|end:31848207

          Length = 1629024

 Score =  55 bits (130), Expect = 3e-006
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 6/80 (7%)
 Frame = -3

Query:     149 YGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTF 208
               ||  ||||.||||| ||    |  ||.|..|||  | . ||    ||     | |     
Sbjct: 1298563 YGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNP----- 1298399

Query:     209 KSFPGIPLHHIFSAAGDDLL 228
                 | |. .   |||.  ..|
Sbjct: 1298398 -RFAGLRVRACFSASLSNVL 1298342

>Zv8_masked||Zv8_scaffold563 |chr5|Len:2237670|start:8937185|end:11174854

          Length = 2237670

 Score =  55 bits (130), Expect = 3e-006
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query:      48 LVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDEN 107
               .| | |||||  ..|     |.  ||  ..   |.||.|.|   .|||||||.||||.  
Sbjct: 1396545 IVQDLMETDLYKLLKTQH--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT 1396372

Query:     108 GVLKLA 113
                 ||..
Sbjct: 1396371 CDLKVS 1396354

>Zv8_masked||Zv8_scaffold1330 |chr11|Len:271527|start:2140542|end:2412068

          Length = 271527

 Score =  55 bits (130), Expect = 3e-006
 Identities = 22/41 (53%), Positives = 30/41 (73%)
 Frame = -2

Query:    132 VVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFL 172
              ||| ||||||.| | . |   ||.|..||| ||..  . ||
Sbjct: 256394 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVFFLYFL 256272

>Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:57849257

          Length = 112022

 Score =  54 bits (129), Expect = 4e-006
 Identities = 23/44 (52%), Positives = 31/44 (70%)
 Frame = +3

Query:    76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 119
             |    | ||||||   |.|.|.|| ||||  .| ||..| |.|.
Sbjct: 52587 YFCQLLDGLEYLHSQGIVHKDIKPGNLLLTTDGALKISDLGVAE 52718

>Zv8_masked||Zv8_scaffold246 |chr2|Len:112022|start:57737236|end:57849257

          Length = 112022

 Score =  54 bits (129), Expect = 4e-006
 Identities = 23/44 (52%), Positives = 31/44 (70%)
 Frame = -1

Query:    76 YMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAK 119
             |    | ||||||   |.|.|.|| ||||  .| ||..| |.|.
Sbjct: 34583 YFCQLLDGLEYLHSQGIVHKDIKPGNLLLTTDGALKISDLGVAE 34452

>Zv8_masked||Zv8_scaffold1170 |chr9|Len:3978314|start:40506298|end:44484611

          Length = 3978314

 Score =  54 bits (129), Expect = 4e-006
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +2

Query:      73 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSF 121
               . ||..  ||||.|||   ||| |.|| |...    |.|. ||| |..|
Sbjct: 1423466 VVAYIVQILQGLDYLHSRRILHLDIKPENIIVTYMNVVKIIDFGSAQTF 1423612

>Zv8_masked||Zv8_scaffold1145 |chr9|Len:715037|start:8561843|end:9276879

          Length = 715037

 Score =  54 bits (129), Expect = 4e-006
 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 3/60 (5%)
 Frame = -1

Query:     66 LVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLD-ENGVLKLADFGLAKSFGSP 124
              | |  | .. ||    . | |.|   | |||.|| ||||| .  |||| |||  .| |.|
Sbjct: 419060 LFLLSSSLQLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFG--RSVGNP 418887

>Zv8_masked||Zv8_scaffold329 |chr3|Len:5518937|start:33903330|end:39422266

          Length = 5518937

 Score =  54 bits (129), Expect = 4e-006
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 7/56 (12%)
 Frame = -3

Query:      77 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQV 132
               |   | ||..|| . ..||||||.|.|.   | .|.||||||       | ||...
Sbjct: 2398875 MRQLLSGLDFLHTNSVIHRDLKPDNVLVSSRGEVKIADFGLA-------RIYTYRI 2398729

>Zv8_masked||Zv8_scaffold766 |chr6|Len:2230761|start:8740965|end:10971725

          Length = 2230761

 Score =  54 bits (129), Expect = 4e-006
 Identities = 25/44 (56%), Positives = 31/44 (70%)
 Frame = -3

Query:      73 IKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFG 116
               .. .|   |.|| |.|   |||||||| |||.   | |||||||
Sbjct: 2009698 LQLFMFQLLRGLSYIHGRRILHRDLKPQNLLISYLGELKLADFG 2009567

>Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end:24353001

          Length = 1347008

 Score =  54 bits (128), Expect = 5e-006
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = -2

Query:     48 LVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDEN 107
              .| | |||||  ..|     |.  ||  ..   |.||.|.|   .|||||||.|||..  
Sbjct: 483667 IVQDLMETDLYKLLKTQQ--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTT 483494

Query:    108 GVLKL 112
                ||.
Sbjct: 483493 CDLKV 483479

>Zv8_masked||Zv8_scaffold317 |chr3|Len:1347008|start:23005994|end:24353001

          Length = 1347008

 Score =  54 bits (128), Expect = 5e-006
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = -2

Query:     48 LVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDEN 107
              .| | |||||  ..|     |.  ||  ..   |.||.|.|   .|||||||.|||..  
Sbjct: 380197 IVQDLMETDLYKLLKTQQ--LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTT 380024

Query:    108 GVLKL 112
                ||.
Sbjct: 380023 CDLKV 380009

>Zv8_masked||Zv8_scaffold1100 |chr8|Len:102366|start:54871076|end:54973441

          Length = 102366

 Score =  54 bits (128), Expect = 5e-006
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +2

Query:    60 IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL 112
             |  |||  .    .|  |.  |.|. .|| .|||||||| .||||   |.||.
Sbjct: 42017 ICADNS--VCSGEVKTLMIQLLRGVRHLHDNWILHRDLKTSNLLLSHKGILKV 42169

>Zv8_masked||Zv8_scaffold1478 |chr12|Len:2442963|start:23770607|end:26213569

          Length = 2442963

 Score =  54 bits (127), Expect = 7e-006
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = +2

Query:     74 KAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFG 122
              .. |   |. ..|||   |.|||||| |.|||. | |||.||| .   |
Sbjct: 575186 RSMMRALLEAVQYLHALNIVHRDLKPENILLDDQGHLKLSDFGFSVQLG 575332

>Zv8_masked||Zv8_scaffold594 |chr5|Len:4011890|start:26583744|end:30595633

          Length = 4011890

 Score =  53 bits (126), Expect = 9e-006
 Identities = 23/37 (62%), Positives = 28/37 (75%)
 Frame = +2

Query:      81 LQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGL 117
               .  | ||| | |||||.|| |.|| . ||.|| ||||
Sbjct: 1945034 VSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGL 1945144

>Zv8_masked||Zv8_scaffold1315 |chr11|Len:61577|start:1|end:61577

          Length = 61577

 Score =  53 bits (125), Expect = 1e-005
 Identities = 24/45 (53%), Positives = 32/45 (71%)
 Frame = +3

Query:    77 MLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSF 121
             |   | || .|| . .||||||| |.|.   | .||||||||. .
Sbjct: 54645 MQQLLCGLAFLHTNRVLHRDLKPENILVTSRGQVKLADFGLARIY 54779

>Zv8_masked||Zv8_NA1118 |chrNA|Len:18380

          Length = 18380

 Score =  53 bits (125), Expect = 1e-005
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query:   39 AFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLK 98
            ||  .  . || .||    ... . ..  .     . |    .  |. .|    .|||.|
Sbjct: 5781 AFQDEKYLYLVMEFMPGG-DLVTRTSNYDIPEEWAQFYTAEVVLALDAIHSLGFIHRDIK 5957

Query:   99 PNNLLLDENGVLKLADFGLAKSFGS 123
            |.|.||| || |||||||      |
Sbjct: 5958 PDNMLLDRNGHLKLADFGTCTKMDS 6032

>Zv8_masked||Zv8_scaffold2320 |chr19|Len:184418|start:46205290|end:46389707

          Length = 184418

 Score =  52 bits (124), Expect = 2e-005
 Identities = 22/46 (47%), Positives = 31/46 (67%)
 Frame = +2

Query:   149 YGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 194
             |  |||||..||||||.||  |  || | ..|. .|   .  |. |
Sbjct: 22865 YTKGVDMWSIGCILAEMLLGKPLFPGTSTINQIEKIMNVIPHPSTE 23002

 
    Posted date:  Mon Feb 02 16:56:45 2009
  Number of letters in database: 493,649,665
  Number of sequences in database:  14,546

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,280,994,843
Number of Sequences: 14546
Number of Extensions: 3280994843
Number of Successful Extensions: 106970508
Number of sequences better than 0.0: 0
TBLASTN 7.6.0