BLASTP 7.6.0


Query=uc003rnz |6_cox_hap1|U65585|P01912|HB2B_HUMAN|HLA-DRB1|NA|NA|HLA class II
       histocompatibility antigen, DR-1 beta chain precursor (Clone P2-beta-3)
        (266 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold576 |chr6|Len:304303|start:8241381|end:8...     80   5e-014
Zv7_masked||Zv7_scaffold839 |chr8|Len:268909|start:49116706|end:...     63   7e-009
Zv7_masked||Zv7_scaffold885 |chr8|Len:63479|start:56137207|end:5...     48   3e-004

>Zv7_masked||Zv7_scaffold576 |chr6|Len:304303|start:8241381|end:8545683

          Length = 304303

 Score =  80 bits (196), Expect = 5e-014
 Identities = 34/99 (34%), Positives = 57/99 (57%)
 Frame = -1

Query:   119 TVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIH 178
             |.   | | | .|    .     |.| |  .||||| |..|.| |||.    . .. |..
Sbjct: 44701 TLFSTVRPSVIMYAEFPEEEGKANVLYCYATGFYPGDIDIRFFLNGQKSTAKLETSDLMY 44522

Query:   179 NGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEW 217
               ||||.    ..  |..|. |||.| | |.. |    |
Sbjct: 44521 GEDWTFRVFKYMKITPQTGDEYTCEVRHSSMSEPKITVW 44405

>Zv7_masked||Zv7_scaffold839 |chr8|Len:268909|start:49116706|end:49385614

          Length = 268909

 Score =  63 bits (152), Expect = 7e-009
 Identities = 37/90 (41%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = -2

Query:    126 PKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQE-EKTGVVSTGLIHNGDWTF 184
              ||| ||          | |.| ||||.|  | .   .|||  |||    | |     | |
Sbjct: 174567 PKVQVYSRNPGEYDKENTLICYVSGFHPPDITIELLKNGQPIEKT--TQTDLAFEQGWFF 174394

Query:    185 QTLVMLETVPRSGEVYTCQVEHPSVTSPLT 214
                       || |||||||| | . |   |
Sbjct: 174393 HLTKFAAFKPRPGEVYTCQVRHLTETKTYT 174304

>Zv7_masked||Zv7_scaffold885 |chr8|Len:63479|start:56137207|end:56200685

          Length = 63479

 Score =  48 bits (112), Expect = 3e-004
 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query:    55 YLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGV 114
             |.|  . |.    .|.| .| .   .| |  .|||||.    .||.|  |. .|.||  .
Sbjct: 13859 YIDSKYFNKYLFAQFNSTLGRYVGFSEYGIRNAEYWNN-GTFVEQERNEVERFCKHNAQI 14035

Query:   115 VESFTVQR 122
              .|  . .
Sbjct: 14036 RDSAVISK 14059

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0