BLASTP 7.6.0


Query=uc003rli
       |6_cox_hap1|NM_032454|P49842|STK19_HUMAN|STK19|NM_032454|NP_115830|serin
       e/threonine kinase 19 isoform 2
        (368 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     78   4e-013
Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     78   4e-013
Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     63   1e-008
Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     63   1e-008
Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     51   4e-005
Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:...     51   4e-005

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  78 bits (190), Expect = 4e-013
 Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 4/82 (4%)
 Frame = -1

Query:    191 ELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVCDCVLKACDGRPYAGAVQKFLASVLPAC 250
              .|.| ||. . ||||| .|  ..| |||| .    ||.   ||   || .|||  ..| |
Sbjct: 269494 DLRENGELLMFQLGFDSEAFALVFAEDYRAK----VLQEEAGRKTLGAAEKFLDKLIPGC 269327

Query:    251 GDLSFQQDQMTQTFGFRDSEIT 272
               |||| .|.| . | | |||||
Sbjct: 269326 SDLSFNKDKMLKEFLFSDSEIT 269261

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  78 bits (190), Expect = 4e-013
 Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 4/82 (4%)
 Frame = -3

Query:    191 ELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVCDCVLKACDGRPYAGAVQKFLASVLPAC 250
              .|.| ||. . ||||| .|  ..| |||| .    ||.   ||   || .|||  ..| |
Sbjct: 168179 DLRENGELLMFQLGFDSEAFALVFAEDYRAK----VLQEEAGRKTLGAAEKFLDKLIPGC 168012

Query:    251 GDLSFQQDQMTQTFGFRDSEIT 272
               |||| .|.| . | | |||||
Sbjct: 168011 SDLSFNKDKMLKEFLFSDSEIT 167946

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  63 bits (151), Expect = 1e-008
 Identities = 26/40 (65%), Positives = 32/40 (80%)
 Frame = -1

Query:    274 LVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMV 313
              || .|.|||||||||||..| .|||||||.|||      |
Sbjct: 261142 LVKSGLLTVRDAGSWWLSIPNSGRFIKYFIKGR....VCV 261023

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  63 bits (151), Expect = 1e-008
 Identities = 26/40 (65%), Positives = 32/40 (80%)
 Frame = -3

Query:    274 LVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMV 313
              || .|.|||||||||||..| .|||||||.|||      |
Sbjct: 159827 LVKSGLLTVRDAGSWWLSIPNSGRFIKYFIKGR....VCV 159708

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  51 bits (121), Expect = 4e-005
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = -1

Query:    302 FVKGRQAVLSMVRKAKYRXXXXXXXXGRRAPVVVRLGLTYHVHDLIGAQLVD 353
              |. ||.|||.||.|.||          ||    |.  . |||||.||| ||.
Sbjct: 258103 FLTGRKAVLNMVKKSKYSEILRTELEERRTTAQVKFQMKYHVHDIIGADLVE 257948

>Zv7_masked||Zv7_scaffold260 |chr3|Len:753910|start:46173352|end:46927261

          Length = 753910

 Score =  51 bits (121), Expect = 4e-005
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = -3

Query:    302 FVKGRQAVLSMVRKAKYRXXXXXXXXGRRAPVVVRLGLTYHVHDLIGAQLVD 353
              |. ||.|||.||.|.||          ||    |.  . |||||.||| ||.
Sbjct: 156788 FLTGRKAVLNMVKKSKYSEILRTELEERRTTAQVKFQMKYHVHDIIGADLVE 156633

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0