BLASTP 7.6.0


Query=uc003rkj |6_cox_hap1|AK092866|NA|NA|EHMT2|NM_025256|NP_079532|HLA-B
       associated transcript 8 isoform b
        (408 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...    125   3e-027
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     99   3e-019
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     97   1e-018
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     96   2e-018
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     92   3e-017
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     90   1e-016
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     85   4e-015
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     84   5e-015
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     80   1e-013
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     79   2e-013
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     79   2e-013
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     75   4e-012
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     75   4e-012
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     75   4e-012
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     74   1e-011
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     68   5e-010
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     66   2e-009
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     64   1e-008
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     62   2e-008
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     58   4e-007
Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|en...     57   7e-007
Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|e...     57   1e-006
Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|e...     57   1e-006
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     56   2e-006
Zv7_masked||Zv7_scaffold1488 |chr15|Len:3359143|start:20199080|e...     55   4e-006
Zv7_masked||Zv7_scaffold1093 |chr11|Len:1799994|start:33145713|e...     55   5e-006
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     55   5e-006
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     54   1e-005
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     53   1e-005
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     53   2e-005
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     52   4e-005
Zv7_masked||Zv7_scaffold1018 |chr10|Len:2459525|start:29738725|e...     49   3e-004
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     48   6e-004
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     45   0.003
Zv7_masked||Zv7_scaffold724 |chr7|Len:3727311|start:54025964|end...     44   0.006

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  125 bits (313), Expect = 3e-027
 Identities = 61/68 (89%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query:   284 LFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIR 343
             .| || .|||||||||||||||||||||||||||||||||||||||||||||||||||| 
Sbjct: 11732 IFLLD-QDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIF 11908

Query:   344 TGEELGFD 351
             ||.||| |
Sbjct: 11909 TGQELG*D 11932

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  99 bits (244), Expect = 3e-019
 Identities = 40/58 (68%), Positives = 51/58 (87%)
 Frame = -1

Query:    292 GEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELG 349
              || |||| ..|||.|||.||||.||. |||||  |||.||||||||.|. |. |.|||
Sbjct: 992754 GEAYCIDGQFYGNVSRFMNHLCEPNLFPVRVFTKHQDMRFPRIAFFASKHIQAGDELG 992581

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  97 bits (239), Expect = 1e-018
 Identities = 40/60 (66%), Positives = 51/60 (85%)
 Frame = -3

Query:     292 GEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFD 351
               |..||.|||.|||||||||| |.||..| |||  ||||||| ||||. ..|  |.||| |
Sbjct: 1221958 GDMYCVDARFYGNISRFINHHCEPNLLPCRVFTSHQDLRFPHIAFFACKNISAGDELGSD 1221779

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  96 bits (236), Expect = 2e-018
 Identities = 42/48 (87%), Positives = 44/48 (91%)
 Frame = +3

Query:  123 DVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQ 170
            |||.|||||||||||||| | || |||||.|||||| |||||||||||
Sbjct: 9051 DVAQGYENVPIPCVNGVDDEGCPSDYKYIAENCETSAMNIDRNITHLQ 9194

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  92 bits (227), Expect = 3e-017
 Identities = 41/42 (97%), Positives = 42/42 (100%)
 Frame = +3

Query:   350 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLD 391
             |||||||||||||||||||||||||||||||||||||||||.
Sbjct: 13218 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLE 13343

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  90 bits (222), Expect = 1e-016
 Identities = 37/61 (60%), Positives = 48/61 (78%)
 Frame = -1

Query:     110 GNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHL 169
               | . |    |. ||.||||| ||.|||| || ||||..|||. ..| || .|||.|||||
Sbjct: 1228392 GTKPINDCVIVFRDIARGYEKVPVPCVNAVDSEPCPDNYKYVPDSCVTSPLNIDKNITHL 1228213

Query:     170 Q 170
               |
Sbjct: 1228212 Q 1228210

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  85 bits (208), Expect = 4e-015
 Identities = 35/49 (71%), Positives = 42/49 (85%)
 Frame = -2

Query:    122 RDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQ 170
              |||.||||..|.||||||| |||| ..||| ||| || .||| || |||
Sbjct: 996512 RDVSRGYEDIPVPCVNGVDHEPCPSNFKYIPENCFTSQVNIDENIKHLQ 996366

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  84 bits (207), Expect = 5e-015
 Identities = 37/51 (72%), Positives = 42/51 (82%)
 Frame = +2

Query:   15 EENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCV 65
            | |.||||||| ||| |||..||| | | .|| ||||||||.||| | |||
Sbjct: 7010 EMNVCLHWASFAGSAEIAELVLNAGCPLSSVNVHGDTPLHISAREGYSDCV 7162

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  80 bits (195), Expect = 1e-013
 Identities = 52/138 (37%), Positives = 76/138 (55%), Gaps = 14/138 (10%)
 Frame = +1

Query:     137 NGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSS---SNCLCGQLSIRCW 193
               | || .  |... ||.||       .| |   .  | | .|| |     |  | |  |  
Sbjct: 1088119 NEVDMDGPPKNFTYINEN--KLGKGVDMNAV-IVGCEC-EDCVSQPVDGCCPGLLKFRRA 1088286

Query:     194 YDKDGRLLQEFNKIEPPL-IFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAK-MGWGVR 251
               |..  |.     |. | . |.|||  | |  .| ||||| ||.  | ...|    |||||
Sbjct: 1088287 YNESRRV-----KVMPGVPIYECNSKCRCGPDCANRVVQRGIQYDLCIFKTDNGRGWGVR 1088451

Query:     252 ALQTIPQGTFICEYVGEL 269
                || | . .|. ||.||.
Sbjct: 1088452 TLQRINKNSFVMEYLGEV 1088505

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  79 bits (194), Expect = 2e-013
 Identities = 34/52 (65%), Positives = 43/52 (82%)
 Frame = -1

Query:      15 EENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVL 66
               |||.|||||.|.|   ||..||. | |||||| ||||||||| |..  |||.
Sbjct: 1000014 EENLCLHWAAFSGCDEIAQLLLDHRSDLHAVNVHGDTPLHIAVRQNQLDCVM 999859

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  79 bits (193), Expect = 2e-013
 Identities = 33/51 (64%), Positives = 41/51 (80%)
 Frame = -1

Query:      15 EENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCV 65
               |||||||||.|.|   |||. | |.|||. .| |||.|||||.||   |||
Sbjct: 1231521 EENICLHWAAFSGCVEIAEIFLTAKCDLNTMNIHGDSPLHIASREGRLDCV 1231369

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  75 bits (182), Expect = 4e-012
 Identities = 33/40 (82%), Positives = 36/40 (90%)
 Frame = +2

Query:  196 KDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 235
            .| |||||||||||||||||| |||| . |||||||.|||
Sbjct: 9539 QDHRLLQEFNKIEPPLIFECNMACSCHKTCKNRVVQAGIK 9658

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  75 bits (182), Expect = 4e-012
 Identities = 30/51 (58%), Positives = 39/51 (76%)
 Frame = -1

Query:     185 CGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 235
               |   .. | . .. ||| ||.  ||||||||| |||||| |||||||.|..
Sbjct: 1226592 CVSRNVFCLWQQESRLLPEFSNEEPPLIFECNHACSCWRTCKNRVVQNGLR 1226440

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  75 bits (182), Expect = 4e-012
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 12/137 (8%)
 Frame = -2

Query:     137 NGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSS--SNCLCGQLSIRCWY 194
               | || |  |. . ||..      . ..        | | |  .|    |  |    .  |
Sbjct: 3434386 NQVDLEGPPKSFTYINDYKVGDGILLNEVSV---GCECTDCLASPVEGCCAGASQHKFAY 3434216

Query:     195 DKDGRLLQEFNKIEPPL-IFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAK-MGWGVRA 252
               .. |..     .| | | |.|||. | |  .| ||||| ||.  | ..||    ||||| 
Sbjct: 3434215 NELGQV-----RIRPGLPIYECNKRCRCGPDCSNRVVQRGIRYSLCIFRTDNGRGWGVRT 3434051

Query:     253 LQTIPQGTFICEYVGEL 269
               .. | . ||. |||||.
Sbjct: 3434050 MERIRKNTFVMEYVGEV 3434000

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  74 bits (179), Expect = 1e-011
 Identities = 35/58 (60%), Positives = 43/58 (74%)
 Frame = +3

Query:   67 LFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDV 124
            |||||||. .. ||||||   |    . || |||.||||| |. || .|||.|||| |
Sbjct: 7932 LFLSRGADIDIVNKEGDTPLSLARGETPVWVALQINRKLRRGIANRIVRTERIICRSV 8105

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  68 bits (164), Expect = 5e-010
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -1

Query:    197 DGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 235
              |||||.|| . .|| .|||| |||||| |.|||.|.|..
Sbjct: 995979 DGRLLKEFCRDDPPFLFECNHACSCWRTCRNRVIQNGLR 995863

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  66 bits (159), Expect = 2e-009
 Identities = 25/27 (92%), Positives = 26/27 (96%)
 Frame = +3

Query:  170 QHCTCVDDCSSSNCLCGQLSIRCWYDK 196
            |||.| |||||||||||||||||||||
Sbjct: 9369 QHCSCTDDCSSSNCLCGQLSIRCWYDK 9449

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  64 bits (153), Expect = 1e-008
 Identities = 30/38 (78%), Positives = 32/38 (84%)
 Frame = +3

Query:   235 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISD 272
             .|||||||| |||||||||| ||||.|||| |  | ||
Sbjct:  9972 RVRLQLYRTEKMGWGVRALQDIPQGSFICECVLSLFSD 10085

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  62 bits (150), Expect = 2e-008
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = -3

Query:     350 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQS 385
               ||||| |||.| | | |.||| |||||| |||  |.
Sbjct: 1219966 FDYGDHFWDVKGKLFNCKCGSSKCKHSAAAIAQTQA 1219859

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  58 bits (139), Expect = 4e-007
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = -2

Query:     170 QHCTCVDDCSSSNCLCGQLSIRCWYDKDG---RLLQEFNKIEPPLIFECNQAC 219
               |.| | |||||..|.|||||.||||||        .     .  | | ||  |
Sbjct: 1228130 QYCVCKDDCSSASCMCGQLSLRCWYDKVSPFHNTSESLKSKQCALQF*CNLLC 1227972

>Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|end:8405673

          Length = 3940805

 Score =  57 bits (137), Expect = 7e-007
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 9/92 (9%)
 Frame = +1

Query:     283 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 342
               |.| .|. |     .||  .|| .||||| ||||     . .  |      |  |. | |
Sbjct: 2484655 YMFRIDDFD----VVDATMHGNAARFINHSCDPNCYSRVINVEGQ----KHIVIFALRKI 2484810

Query:     343 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 374
                 |||| .||     |  .|   | ||. .|.
Sbjct: 2484811 YRGEELTYDYKFPIEDADNK-LHCNCGARRCR 2484903

>Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|end:35046640

          Length = 1104212

 Score =  57 bits (135), Expect = 1e-006
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 9/92 (9%)
 Frame = -2

Query:    283 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 342
              |.| .|. |     .||  .|| .||||| |.||     . .  |      |  |. | |
Sbjct: 256573 YMFRIDDFD----VVDATMHGNAARFINHSCEPNCYSRVINVEGQ----KHIVIFALRKI 256418

Query:    343 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 374
                |||| .||     |  .|   | ||...|.
Sbjct: 256417 YRGEELTYDYKFPIEDASNK-LGCNCGAKRCR 256325

>Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|end:35046640

          Length = 1104212

 Score =  57 bits (135), Expect = 1e-006
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 9/92 (9%)
 Frame = -3

Query:   283 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 342
             |.| .|. |     .||  .|| .||||| |.||     . .  |      |  |. | |
Sbjct: 97455 YMFRIDDFD----VVDATMHGNAARFINHSCEPNCYSRVINVEGQ----KHIVIFALRKI 97300

Query:   343 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 374
               |||| .||     |  .|   | ||...|.
Sbjct: 97299 YRGEELTYDYKFPIEDASNK-LGCNCGAKRCR 97207

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  56 bits (133), Expect = 2e-006
 Identities = 26/26 (100%)
 Frame = +1

Query:   265 YVGELISDAEADVREDDSYLFDLDNK 290
             ||||||||||||||||||||||||||
Sbjct: 11047 YVGELISDAEADVREDDSYLFDLDNK 11124

>Zv7_masked||Zv7_scaffold1488 |chr15|Len:3359143|start:20199080|end:23558222

          Length = 3359143

 Score =  55 bits (131), Expect = 4e-006
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 9/92 (9%)
 Frame = +1

Query:     283 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 342
               |.| .|  | ||  .||  .|| .||||| |.||     | .  |      |  |..| |
Sbjct: 2566534 YMFRID--DYEV--VDATIHGNSARFINHSCEPNCYSRVVNVDGQ----KHIVIFATRKI 2566689

Query:     343 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 374
                 |||| .||     .  .|   | ||..||.
Sbjct: 2566690 YKGEELTYDYKFPIEEPGNK-LPCNCGAKKCR 2566782

>Zv7_masked||Zv7_scaffold1093 |chr11|Len:1799994|start:33145713|end:34945706

          Length = 1799994

 Score =  55 bits (130), Expect = 5e-006
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = -1

Query:    297 IDARYYGNISRFINHLCDPNII--PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDY 352
              .|    ||. ||||| | ||.|  ||||  .      ||.| |..|||   ||| |||
Sbjct: 902187 VDPVNLGNVGRFINHSCQPNLIMLPVRVHSV-----LPRLALFANRDIECYEELTFDY 902029

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  55 bits (130), Expect = 5e-006
 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 6/55 (10%)
 Frame = -1

Query:    235 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDN 289
              ..|||..|| .|||||| || ||.| |.|||      |    |  . | || | |
Sbjct: 995241 RLRLQVFRTERMGWGVRTLQDIPEGGFVCEY------D....VYLNISCLFTLTN 995095

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  54 bits (127), Expect = 1e-005
 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = -3

Query:     238 LQLYRTAKMGWGVRALQTIPQGTFIC-EYVGELISDAEADVREDDSYLFDLDNK 290
               | |.. | |   |  .   |  .| |  ||||.||||||||||.||||| ||.|
Sbjct: 1224610 LCLFKCASMDMIVGLVCLHPNVSFPCNRYVGEIISDAEADVRENDSYLFSLDSK 1224449

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  53 bits (126), Expect = 1e-005
 Identities = 20/29 (68%), Positives = 23/29 (79%)
 Frame = -3

Query:    348 LGFDYGDRFWDIKSKYFTCQCGSEKCKHS 376
              | ||||| .| || ||| ||||| ||..|
Sbjct: 992452 LRFDYGDHYWQIKKKYFRCQCGSGKCRYS 992366

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  53 bits (125), Expect = 2e-005
 Identities = 22/37 (59%), Positives = 29/37 (78%)
 Frame = -2

Query:     235 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELIS 271
               . ||||..|  |||||. || ||||||.|| |  |..
Sbjct: 1224776 RTRLQLFKTQMMGWGVKTLQDIPQGTFVCE*VSYLLA 1224666

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  52 bits (122), Expect = 4e-005
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -2

Query:     313 CDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFT 365
               ||||.    ||. . | | ||||||..| |. |||| |||     ..|| | |
Sbjct: 3431191 CDPNLQVYNVFIDNLDERLPRIAFFATRGIKAGEELTFDY-----NMKSMYRT 3431048

>Zv7_masked||Zv7_scaffold1018 |chr10|Len:2459525|start:29738725|end:32198249

          Length = 2459525

 Score =  49 bits (115), Expect = 3e-004
 Identities = 26/88 (29%), Positives = 45/88 (51%)
 Frame = -3

Query:       1 MLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARES 60
               .|  .  .|   | ..   ||.|.  |  |.  .||.    ..  .  | || |||    
Sbjct: 1784580 LLSRKTTNVNAKDEDQYTPLHFAAQNGDEALTRLLLDRSASINETDAQGRTPTHIACHHG 1784401

Query:      61 YHDCVLLFLSRGANPELRNKEGDTAWDL 88
                 . | . |||||.  .. |.  ||  |
Sbjct: 1784400 QENVVRVLLSRGADVHVKGKDDWTALHL 1784317

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  48 bits (112), Expect = 6e-004
 Identities = 22/40 (55%), Positives = 27/40 (67%)
 Frame = +2

Query:     313 CDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDY 352
               ||||.    ||. . | | |||| |. | |. |||| |||
Sbjct: 1095083 CDPNLQVYNVFIDNLDERLPRIALFAKRGIKAGEELTFDY 1095202

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  45 bits (106), Expect = 0.003
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = -1

Query:      67 LFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKII 120
               |||||||.  |.||||.   .     | || ||| |.| |     .|  |||..
Sbjct: 1228623 LFLSRGADVNLKNKEGEMPMECCSHSSKVWNALQANKKQR-EANRKAGATEKLL 1228465

>Zv7_masked||Zv7_scaffold724 |chr7|Len:3727311|start:54025964|end:57753274

          Length = 3727311

 Score =  44 bits (103), Expect = 0.006
 Identities = 27/70 (38%), Positives = 33/70 (47%)
 Frame = -3

Query:      11 LTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLS 70
               |   |.   || ||  |   | ..||       |   .| ||||||||| . |   . | 
Sbjct: 2942596 LPHQEDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLE 2942417

Query:      71 RGANPELRNK 80
                ||   |  |
Sbjct: 2942416 AGAAHSLATK 2942387

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0