BLASTP 7.6.0


Query=uc003rki |6_cox_hap1|CR596486|NA|NA|EHMT2|NM_025256|NP_079532|HLA-B
       associated transcript 8 isoform b
        (249 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...    125   1e-027
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     99   1e-019
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     97   5e-019
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     92   1e-017
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     75   2e-012
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     75   2e-012
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     74   4e-012
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     71   2e-011
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     71   3e-011
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     68   2e-010
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     66   9e-010
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     64   4e-009
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     62   1e-008
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     58   2e-007
Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|en...     57   3e-007
Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|e...     57   5e-007
Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|e...     57   5e-007
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     56   7e-007
Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end...     56   9e-007
Zv7_masked||Zv7_scaffold1488 |chr15|Len:3359143|start:20199080|e...     55   2e-006
Zv7_masked||Zv7_scaffold1093 |chr11|Len:1799994|start:33145713|e...     55   2e-006
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     55   2e-006
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     54   5e-006
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     53   6e-006
Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|en...     53   8e-006
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     52   2e-005
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     48   2e-004
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     48   3e-004
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     45   0.002
Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end...     44   0.004

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  125 bits (313), Expect = 1e-027
 Identities = 61/68 (89%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query:   125 LFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIR 184
             .| || .|||||||||||||||||||||||||||||||||||||||||||||||||||| 
Sbjct: 11732 IFLLD-QDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIF 11908

Query:   185 TGEELGFD 192
             ||.||| |
Sbjct: 11909 TGQELG*D 11932

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  99 bits (244), Expect = 1e-019
 Identities = 40/58 (68%), Positives = 51/58 (87%)
 Frame = -1

Query:    133 GEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELG 190
              || |||| ..|||.|||.||||.||. |||||  |||.||||||||.|. |. |.|||
Sbjct: 992754 GEAYCIDGQFYGNVSRFMNHLCEPNLFPVRVFTKHQDMRFPRIAFFASKHIQAGDELG 992581

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  97 bits (239), Expect = 5e-019
 Identities = 40/60 (66%), Positives = 51/60 (85%)
 Frame = -3

Query:     133 GEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFD 192
               |..||.|||.|||||||||| |.||..| |||  ||||||| ||||. ..|  |.||| |
Sbjct: 1221958 GDMYCVDARFYGNISRFINHHCEPNLLPCRVFTSHQDLRFPHIAFFACKNISAGDELGSD 1221779

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  92 bits (227), Expect = 1e-017
 Identities = 41/42 (97%), Positives = 42/42 (100%)
 Frame = +3

Query:   191 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLD 232
             |||||||||||||||||||||||||||||||||||||||||.
Sbjct: 13218 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLE 13343

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  75 bits (182), Expect = 2e-012
 Identities = 33/40 (82%), Positives = 36/40 (90%)
 Frame = +2

Query:   37 KDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 76
            .| |||||||||||||||||| |||| . |||||||.|||
Sbjct: 9539 QDHRLLQEFNKIEPPLIFECNMACSCHKTCKNRVVQAGIK 9658

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  75 bits (182), Expect = 2e-012
 Identities = 30/51 (58%), Positives = 39/51 (76%)
 Frame = -1

Query:      26 CGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 76
               |   .. | . .. ||| ||.  ||||||||| |||||| |||||||.|..
Sbjct: 1226592 CVSRNVFCLWQQESRLLPEFSNEEPPLIFECNHACSCWRTCKNRVVQNGLR 1226440

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  74 bits (179), Expect = 4e-012
 Identities = 41/102 (40%), Positives = 59/102 (57%), Gaps = 9/102 (8%)
 Frame = -2

Query:      13 CTCVDDCSS--SNCLCGQLSIRCWYDKDGRLLQEFNKIEPPL-IFECNQACSCWRNCKNR 69
               | | |  .|    |  |    .  |.. |..     .| | | |.|||. | |  .| ||
Sbjct: 3434290 CECTDCLASPVEGCCAGASQHKFAYNELGQV-----RIRPGLPIYECNKRCRCGPDCSNR 3434126

Query:      70 VVQSGIKVRLQLYRTAK-MGWGVRALQTIPQGTFICEYVGEL 110
               ||| ||.  | ..||    ||||| .. | . ||. |||||.
Sbjct: 3434125 VVQRGIRYSLCIFRTDNGRGWGVRTMERIRKNTFVMEYVGEV 3434000

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  71 bits (173), Expect = 2e-011
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 11/103 (10%)
 Frame = +1

Query:      13 CTCVDDCSS---SNCLCGQLSIRCWYDKDGRLLQEFNKIEPPL-IFECNQACSCWRNCKN 68
               | | .|| |     |  | |  |  |..  |.     |. | . |.|||  | |  .| |
Sbjct: 1088215 CEC-EDCVSQPVDGCCPGLLKFRRAYNESRRV-----KVMPGVPIYECNSKCRCGPDCAN 1088376

Query:      69 RVVQSGIKVRLQLYRTAK-MGWGVRALQTIPQGTFICEYVGEL 110
               |||| ||.  | ...|    ||||| || | . .|. ||.||.
Sbjct: 1088377 RVVQRGIQYDLCIFKTDNGRGWGVRTLQRINKNSFVMEYLGEV 1088505

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  71 bits (172), Expect = 3e-011
 Identities = 29/60 (48%), Positives = 43/60 (71%), Gaps = 1/60 (1%)
 Frame = -1

Query:     53 IFECNQACSC-WRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELI 111
              |.|||. | |  . | ||.|| |..|||||..|   |||.| |  | .|.|.| | |. .
Sbjct: 474330 IYECNKRCRCNMQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKTL 474151

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  68 bits (164), Expect = 2e-010
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -1

Query:     38 DGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIK 76
              |||||.|| . .|| .|||| |||||| |.|||.|.|..
Sbjct: 995979 DGRLLKEFCRDDPPFLFECNHACSCWRTCRNRVIQNGLR 995863

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  66 bits (159), Expect = 9e-010
 Identities = 25/27 (92%), Positives = 26/27 (96%)
 Frame = +3

Query:   11 QHCTCVDDCSSSNCLCGQLSIRCWYDK 37
            |||.| |||||||||||||||||||||
Sbjct: 9369 QHCSCTDDCSSSNCLCGQLSIRCWYDK 9449

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  64 bits (153), Expect = 4e-009
 Identities = 30/38 (78%), Positives = 32/38 (84%)
 Frame = +3

Query:    76 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISD 113
             .|||||||| |||||||||| ||||.|||| |  | ||
Sbjct:  9972 RVRLQLYRTEKMGWGVRALQDIPQGSFICECVLSLFSD 10085

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  62 bits (150), Expect = 1e-008
 Identities = 25/36 (69%), Positives = 28/36 (77%)
 Frame = -3

Query:     191 FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQS 226
               ||||| |||.| | | |.||| |||||| |||  |.
Sbjct: 1219966 FDYGDHFWDVKGKLFNCKCGSSKCKHSAAAIAQTQA 1219859

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  58 bits (139), Expect = 2e-007
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = -2

Query:      11 QHCTCVDDCSSSNCLCGQLSIRCWYDKDG---RLLQEFNKIEPPLIFECNQAC 60
               |.| | |||||..|.|||||.||||||        .     .  | | ||  |
Sbjct: 1228130 QYCVCKDDCSSASCMCGQLSLRCWYDKVSPFHNTSESLKSKQCALQF*CNLLC 1227972

>Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|end:8405673

          Length = 3940805

 Score =  57 bits (137), Expect = 3e-007
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 9/92 (9%)
 Frame = +1

Query:     124 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 183
               |.| .|. |     .||  .|| .||||| ||||     . .  |      |  |. | |
Sbjct: 2484655 YMFRIDDFD----VVDATMHGNAARFINHSCDPNCYSRVINVEGQ----KHIVIFALRKI 2484810

Query:     184 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 215
                 |||| .||     |  .|   | ||. .|.
Sbjct: 2484811 YRGEELTYDYKFPIEDADNK-LHCNCGARRCR 2484903

>Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|end:35046640

          Length = 1104212

 Score =  57 bits (135), Expect = 5e-007
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 9/92 (9%)
 Frame = -2

Query:    124 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 183
              |.| .|. |     .||  .|| .||||| |.||     . .  |      |  |. | |
Sbjct: 256573 YMFRIDDFD----VVDATMHGNAARFINHSCEPNCYSRVINVEGQ----KHIVIFALRKI 256418

Query:    184 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 215
                |||| .||     |  .|   | ||...|.
Sbjct: 256417 YRGEELTYDYKFPIEDASNK-LGCNCGAKRCR 256325

>Zv7_masked||Zv7_scaffold1498 |chr15|Len:1104212|start:33942429|end:35046640

          Length = 1104212

 Score =  57 bits (135), Expect = 5e-007
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 9/92 (9%)
 Frame = -3

Query:   124 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 183
             |.| .|. |     .||  .|| .||||| |.||     . .  |      |  |. | |
Sbjct: 97455 YMFRIDDFD----VVDATMHGNAARFINHSCEPNCYSRVINVEGQ----KHIVIFALRKI 97300

Query:   184 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 215
               |||| .||     |  .|   | ||...|.
Sbjct: 97299 YRGEELTYDYKFPIEDASNK-LGCNCGAKRCR 97207

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  56 bits (134), Expect = 7e-007
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = -1

Query:     11 QHCTCVDDCSSSNCLCGQLSIRCWYDKDGR 40
              |||.| |||.||.|.|||||. ||| |  |
Sbjct: 996273 QHCSCKDDCASSSCICGQLSMHCWYGKVSR 996184

>Zv7_masked||Zv7_scaffold1938 |chr19|Len:64119|start:45503648|end:45567766

          Length = 64119

 Score =  56 bits (133), Expect = 9e-007
 Identities = 26/26 (100%)
 Frame = +1

Query:   106 YVGELISDAEADVREDDSYLFDLDNK 131
             ||||||||||||||||||||||||||
Sbjct: 11047 YVGELISDAEADVREDDSYLFDLDNK 11124

>Zv7_masked||Zv7_scaffold1488 |chr15|Len:3359143|start:20199080|end:23558222

          Length = 3359143

 Score =  55 bits (131), Expect = 2e-006
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 9/92 (9%)
 Frame = +1

Query:     124 YLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDI 183
               |.| .|  | ||  .||  .|| .||||| |.||     | .  |      |  |..| |
Sbjct: 2566534 YMFRID--DYEV--VDATIHGNSARFINHSCEPNCYSRVVNVDGQ----KHIVIFATRKI 2566689

Query:     184 RTGEELGFDYGDRFWDIKSKYFTCQCGSEKCK 215
                 |||| .||     .  .|   | ||..||.
Sbjct: 2566690 YKGEELTYDYKFPIEEPGNK-LPCNCGAKKCR 2566782

>Zv7_masked||Zv7_scaffold1093 |chr11|Len:1799994|start:33145713|end:34945706

          Length = 1799994

 Score =  55 bits (130), Expect = 2e-006
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = -1

Query:    138 IDARYYGNISRFINHLCDPNII--PVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDY 193
              .|    ||. ||||| | ||.|  ||||  .      ||.| |..|||   ||| |||
Sbjct: 902187 VDPVNLGNVGRFINHSCQPNLIMLPVRVHSV-----LPRLALFANRDIECYEELTFDY 902029

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  55 bits (130), Expect = 2e-006
 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 6/55 (10%)
 Frame = -1

Query:     76 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDN 130
              ..|||..|| .|||||| || ||.| |.|||      |    |  . | || | |
Sbjct: 995241 RLRLQVFRTERMGWGVRTLQDIPEGGFVCEY------D....VYLNISCLFTLTN 995095

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  54 bits (127), Expect = 5e-006
 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = -3

Query:      79 LQLYRTAKMGWGVRALQTIPQGTFIC-EYVGELISDAEADVREDDSYLFDLDNK 131
               | |.. | |   |  .   |  .| |  ||||.||||||||||.||||| ||.|
Sbjct: 1224610 LCLFKCASMDMIVGLVCLHPNVSFPCNRYVGEIISDAEADVRENDSYLFSLDSK 1224449

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  53 bits (126), Expect = 6e-006
 Identities = 20/29 (68%), Positives = 23/29 (79%)
 Frame = -3

Query:    189 LGFDYGDRFWDIKSKYFTCQCGSEKCKHS 217
              | ||||| .| || ||| ||||| ||..|
Sbjct: 992452 LRFDYGDHYWQIKKKYFRCQCGSGKCRYS 992366

>Zv7_masked||Zv7_scaffold2045 |chr21|Len:1453146|start:5360584|end:6813729

          Length = 1453146

 Score =  53 bits (125), Expect = 8e-006
 Identities = 22/37 (59%), Positives = 29/37 (78%)
 Frame = -2

Query:      76 KVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELIS 112
               . ||||..|  |||||. || ||||||.|| |  |..
Sbjct: 1224776 RTRLQLFKTQMMGWGVKTLQDIPQGTFVCE*VSYLLA 1224666

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  52 bits (122), Expect = 2e-005
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -2

Query:     154 CDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFT 206
               ||||.    ||. . | | ||||||..| |. |||| |||     ..|| | |
Sbjct: 3431191 CDPNLQVYNVFIDNLDERLPRIAFFATRGIKAGEELTFDY-----NMKSMYRT 3431048

>Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end:24212882

          Length = 3929607

 Score =  48 bits (113), Expect = 2e-004
 Identities = 19/36 (52%), Positives = 28/36 (77%)
 Frame = -3

Query:     96 TIPQGTFICEYVGELISDAEADVREDDSYLFDLDNK 131
              |  .   .| . ||.||| ||..||.|||.|.||||
Sbjct: 993022 TCTEDFVLCRFAGEIISDGEANIRENDSYMFNLDNK 992915

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  48 bits (112), Expect = 3e-004
 Identities = 22/40 (55%), Positives = 27/40 (67%)
 Frame = +2

Query:     154 CDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDY 193
               ||||.    ||. . | | |||| |. | |. |||| |||
Sbjct: 1095083 CDPNLQVYNVFIDNLDERLPRIALFAKRGIKAGEELTFDY 1095202

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  45 bits (104), Expect = 0.002
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 7/55 (12%)
 Frame = +2

Query:     109 ELISDAEADVR------EDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPN 157
               ..|.  ||. |      .  .||||||  | .|| ||| .||||| |.||    |
Sbjct: 1091216 QIITTDEAEQRGVLYDKQGVTYLFDLDYVD-DVYTIDAAHYGNISHFVNHSVSTN 1091377

>Zv7_masked||Zv7_scaffold793 |chr8|Len:6180980|start:20734171|end:26915150

          Length = 6180980

 Score =  44 bits (102), Expect = 0.004
 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 1/34 (2%)
 Frame = -1

Query:     119 REDDSYLFDLDNKDGEVYCIDARYYGNISRFINH 152
               .|  .||||||  | | | .|| .||||| |.||
Sbjct: 3432620 KEGATYLFDLDYVDDE-YTVDAAHYGNISHFVNH 3432522

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0