BLASTP 7.6.0


Query=uc003rfs |6_cox_hap1|L76933|Q9TPV9|Q9TPV9_HUMAN|HLA-B|NA|NA|MHC class I
       antigen (Fragment)
        (171 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|en...     64   1e-009
Zv7_masked||Zv7_scaffold2215 |chr22|Len:371666|start:37461184|en...     52   8e-006

>Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|end:8405673

          Length = 3940805

 Score =  64 bits (155), Expect = 1e-009
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 2/93 (2%)
 Frame = +2

Query:     79 AGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQXX-XX 137
              .| || | ||||..  ||   . . |  |||.|.|.|..   .||||.. |  |.     
Sbjct: 315284 SGVHTFQFMYGCEMDDDGN-KQVHWQIGYDGEDFISLDKKTLTWTAANSQAMTTKVKWDS 315460

Query:    138 XXXXXXXXXXXXXGTCVEWLRRYLENGKETLQR 170
                             |.||...|.  ||.||.|
Sbjct: 315461 TGAEANYWKGYLENECIEWVQKYVGYGKDTLER 315559

>Zv7_masked||Zv7_scaffold2215 |chr22|Len:371666|start:37461184|end:37832849

          Length = 371666

 Score =  52 bits (122), Expect = 8e-006
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 1/97 (1%)
 Frame = -3

Query:     74 YNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALN-EDLRSWTAADTAAQIT 132
              |  | .| |  |||||||   .     |.||  |||.||. |.  ..|  |         
Sbjct: 264591 YTCSLSGVHVYQRMYGCDWDEETEESHGFDQYGYDGEDYVMLDMREIRYITPVQQGEITV 264412

Query:    133 QXXXXXXXXXXXXXXXXXGTCVEWLRRYLENGKETLQ 169
              |                   || ||...|   |  |.
Sbjct: 264411 QKWNSNREQLKTLQHYYKYECVYWLKQFLGLRKADLE 264301

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0