BLASTP 7.6.0


Query=uc003reh
       |6_cox_hap1|Z29093|Q2L6H3|Q2L6H3_HUMAN|DDR1|NM_001954|NP_001945|discoidi
       n domain receptor family, member 1
        (876 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold989 |chr10|Len:1489293|start:3098365|end...    179   4e-043
Zv7_masked||Zv7_scaffold587 |chr6|Len:1911348|start:15798737|end...    174   1e-041
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...    143   4e-032
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...    138   1e-030
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...    132   5e-029
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...    129   4e-028
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...    108   9e-022
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...    102   5e-020
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...     99   6e-019
Zv7_masked||Zv7_scaffold1620 |chr16|Len:865587|start:42338361|en...     99   7e-019
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     98   1e-018
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...     98   1e-018
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     98   1e-018
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     96   4e-018
Zv7_masked||Zv7_scaffold474 |chr5|Len:2619322|start:49018611|end...     94   1e-017
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...     94   2e-017
Zv7_masked||Zv7_scaffold799 |chr8|Len:108633|start:33709931|end:...     92   9e-017
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...     91   1e-016
Zv7_masked||Zv7_NA778 |chrNA|Len:33397                                  91   2e-016
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     91   2e-016
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     89   4e-016
Zv7_masked||Zv7_scaffold2424 |chr25|Len:459853|start:7008836|end...     88   1e-015
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     87   2e-015
Zv7_masked||Zv7_scaffold476 |chr5|Len:492374|start:52222926|end:...     87   2e-015
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     85   8e-015
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     83   3e-014
Zv7_masked||Zv7_NA491 |chrNA|Len:10155                                  81   2e-013
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     80   2e-013
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...     78   1e-012
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     77   3e-012
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...     76   5e-012
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     75   7e-012
Zv7_masked||Zv7_scaffold835 |chr8|Len:243529|start:48150984|end:...     75   1e-011
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     74   1e-011
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...     74   1e-011
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     74   2e-011
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     73   3e-011
Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:...     72   7e-011
Zv7_masked||Zv7_scaffold514 |chr5|Len:269613|start:67199677|end:...     71   1e-010
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     70   4e-010
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     70   4e-010
Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end...     66   4e-009
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     64   2e-008
Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4...     64   3e-008
Zv7_masked||Zv7_scaffold1332 |chr13|Len:34786|start:52282794|end...     63   3e-008
Zv7_masked||Zv7_scaffold2250 |chr23|Len:5278691|start:19339444|e...     63   3e-008
Zv7_masked||Zv7_scaffold876 |chr8|Len:139946|start:55049087|end:...     63   4e-008
Zv7_masked||Zv7_scaffold1620 |chr16|Len:865587|start:42338361|en...     62   8e-008
Zv7_masked||Zv7_scaffold1379 |chr14|Len:188558|start:30529220|en...     61   2e-007
Zv7_masked||Zv7_scaffold1948 |chr20|Len:457866|start:1|end:457866       60   3e-007
Zv7_masked||Zv7_scaffold2248 |chr23|Len:5037198|start:13820515|e...     60   3e-007
Zv7_masked||Zv7_scaffold799 |chr8|Len:108633|start:33709931|end:...     60   3e-007
Zv7_masked||Zv7_scaffold1081 |chr11|Len:6306542|start:21135593|e...     60   4e-007
Zv7_masked||Zv7_scaffold2424 |chr25|Len:459853|start:7008836|end...     60   4e-007
Zv7_masked||Zv7_scaffold691 |chr7|Len:541937|start:7352449|end:7...     60   4e-007
Zv7_masked||Zv7_scaffold1797 |chr18|Len:10976257|start:10395834|...     59   5e-007
Zv7_masked||Zv7_scaffold2273 |chr23|Len:586669|start:37633230|en...     59   5e-007
Zv7_masked||Zv7_NA1005 |chrNA|Len:98091                                 59   6e-007
Zv7_masked||Zv7_NA1361 |chrNA|Len:96976                                 59   6e-007
Zv7_masked||Zv7_scaffold1916 |chr19|Len:492483|start:40612043|en...     59   6e-007
Zv7_masked||Zv7_scaffold2163 |chr22|Len:1267999|start:7974207|en...     59   6e-007
Zv7_masked||Zv7_scaffold2248 |chr23|Len:5037198|start:13820515|e...     59   6e-007
Zv7_masked||Zv7_scaffold134 |chr2|Len:1457363|start:31388217|end...     59   8e-007
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     59   8e-007
Zv7_masked||Zv7_scaffold138 |chr2|Len:2223622|start:34119787|end...     58   1e-006
Zv7_masked||Zv7_scaffold1709 |chr17|Len:44926|start:28730141|end...     58   1e-006
Zv7_masked||Zv7_scaffold695 |chr7|Len:885163|start:9732515|end:1...     58   1e-006
Zv7_masked||Zv7_NA1361 |chrNA|Len:96976                                 58   1e-006
Zv7_masked||Zv7_scaffold1379 |chr14|Len:188558|start:30529220|en...     58   1e-006
Zv7_masked||Zv7_NA1005 |chrNA|Len:98091                                 57   2e-006
Zv7_masked||Zv7_scaffold104 |chr2|Len:1711771|start:4470016|end:...     57   2e-006
Zv7_masked||Zv7_scaffold2332 |chr24|Len:1331695|start:25320558|e...     57   2e-006
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...     57   2e-006
Zv7_masked||Zv7_scaffold876 |chr8|Len:139946|start:55049087|end:...     57   2e-006
Zv7_masked||Zv7_scaffold2001 |chr20|Len:275476|start:51359062|en...     57   2e-006
Zv7_masked||Zv7_scaffold2250 |chr23|Len:5278691|start:19339444|e...     57   2e-006
Zv7_masked||Zv7_scaffold474 |chr5|Len:2619322|start:49018611|end...     57   2e-006
Zv7_masked||Zv7_scaffold491 |chr5|Len:579807|start:59246909|end:...     57   2e-006
Zv7_masked||Zv7_scaffold601 |chr6|Len:797929|start:32089889|end:...     57   2e-006
Zv7_masked||Zv7_scaffold135 |chr2|Len:597832|start:32845680|end:...     57   3e-006
Zv7_masked||Zv7_scaffold1575 |chr16|Len:1815160|start:7317645|en...     57   3e-006
Zv7_masked||Zv7_scaffold495 |chr5|Len:156071|start:61208348|end:...     57   3e-006
Zv7_masked||Zv7_scaffold495 |chr5|Len:156071|start:61208348|end:...     57   3e-006
Zv7_masked||Zv7_scaffold1137 |chr12|Len:658977|start:1700309|end...     56   4e-006
Zv7_masked||Zv7_scaffold1849 |chr18|Len:291419|start:45610137|en...     56   4e-006
Zv7_masked||Zv7_scaffold474 |chr5|Len:2619322|start:49018611|end...     56   4e-006
Zv7_masked||Zv7_scaffold1981 |chr20|Len:4174062|start:25147528|e...     56   5e-006
Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:...     56   5e-006
Zv7_masked||Zv7_scaffold791 |chr8|Len:7024399|start:13609402|end...     56   5e-006
Zv7_masked||Zv7_scaffold1668 |chr17|Len:2318822|start:1|end:2318822     55   7e-006
Zv7_masked||Zv7_scaffold34 |chr1|Len:1935043|start:26905028|end:...     55   7e-006
Zv7_masked||Zv7_scaffold1575 |chr16|Len:1815160|start:7317645|en...     55   9e-006
Zv7_masked||Zv7_scaffold2119 |chr21|Len:7825|start:44238328|end:...     55   9e-006
Zv7_masked||Zv7_scaffold126 |chr2|Len:643900|start:25507804|end:...     55   1e-005
Zv7_masked||Zv7_NA3308 |chrNA|Len:9655                                  54   2e-005
Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:...     54   2e-005
Zv7_masked||Zv7_scaffold986 |chr10|Len:938283|start:2114843|end:...     54   2e-005
Zv7_masked||Zv7_scaffold1797 |chr18|Len:10976257|start:10395834|...     54   3e-005
Zv7_masked||Zv7_scaffold138 |chr2|Len:2223622|start:34119787|end...     53   4e-005
Zv7_masked||Zv7_scaffold2163 |chr22|Len:1267999|start:7974207|en...     53   4e-005

>Zv7_masked||Zv7_scaffold989 |chr10|Len:1489293|start:3098365|end:4587657

          Length = 1489293

 Score =  179 bits (453), Expect = 4e-043
 Identities = 96/223 (43%), Positives = 123/223 (55%), Gaps = 14/223 (6%)
 Frame = -3

Query:  652 GVCVQDDPLCMITDYMENGDLNQFLSAH-QLEDKXXXXXXXXXXXXXXXTISYPML---- 706
            |||    |.|.. .||  ||||.||      .                    || |    
Sbjct: 2863 GVCAVGKPMCLMFEYMAYGDLNEFLRRRCATQQPSLSRDTLTSSSLVSEPERYPPLSCQE 2684

Query:  707 -LHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGR 765
             | .. |.|.|| ||.   ||||||||||||| ||  .||||||.|||.|| |||.    
Sbjct: 2683 QLSISKQVAAGMAYLSERKFVHRDLATRNCLVAENLVVKIADFGLSRNIYAADYYKASEN 2504

Query:  766 AVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFR 825
              .|||||  | |   ..|. |||||.|| |||.      ||.  .  |.||     . |
Sbjct: 2503 DAIPIRWMPPESIFYNRYTSESDVWAYGVVLWEIFSY-GMQPYYGMAHEEVI----YYVR 2339

Query:  826 DQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFL 868
            |      || |  ||| || ||  |||     || |. .|| |
Sbjct: 2338 DGN---VLSCPENCPQELYNLMRLCWSGHPTDRPSFASIHRIL 2219

>Zv7_masked||Zv7_scaffold587 |chr6|Len:1911348|start:15798737|end:17710084

          Length = 1911348

 Score =  174 bits (440), Expect = 1e-041
 Identities = 86/208 (41%), Positives = 128/208 (61%), Gaps = 3/208 (1%)
 Frame = -2

Query:     611 HPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENG 670
               |  |||.| |.  ..     || .|  ... |  ||.. ||||  |. |.||. ...  |
Sbjct: 1239443 HAQLVAIKTLKDISSAQHWGDFQQEASVLAELHHPNVVCLLGVVTQEQPVCMLFEFLAQG 1239264

Query:     671 DLNQFLSAHQLEDKXXXXXXXXXXXXXXXTISYPMLLHVAAQIASGMRYLATLNFVHRDL 730
               ||..||                       .. .   ||.| |.|.|| |||.  |.|.||
Sbjct: 1239263 DLHEFLIMR--SPHSDVGCSSDEDGTVKSSLDHGDFLHLAIQVAAGMEYLASHFFIHKDL 1239090

Query:     731 ATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVW 790
               | || ||||   |||.| |.|| .|. ||||||   .||||||  | |. ||..| ||||
Sbjct: 1239089 AARNILVGEQLHIKISDLGLSREIYSSDYYRVQPNTLLPIRWMPPEAIVYGKYSTDSDVW 1238910

Query:     791 AFGVTLWEVLMLCRAQPFGQLTDEQVIE 818
               |||| |||.      ||.   ....|.|
Sbjct: 1238909 AFGVVLWEIFSF-GLQPYYGFSNQEVME 1238829

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  143 bits (358), Expect = 4e-032
 Identities = 65/81 (80%), Positives = 76/81 (93%)
 Frame = -3

Query:    700 TISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDY 759
              . ||  | |.|.||||||.||..||||||||||||||||.||||||||||||||||.|||
Sbjct: 656911 SFSYSNLHHMASQIASGMKYLSSLNFVHRDLATRNCLVGKNFTIKIADFGMSRNLYSGDY 656732

Query:    760 YRVQGRAVLPIRWMAWECILM 780
              ||.|||||||||||.|| ||.
Sbjct: 656731 YRIQGRAVLPIRWMSWESILL 656669

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  138 bits (346), Expect = 1e-030
 Identities = 59/80 (73%), Positives = 69/80 (86%)
 Frame = -3

Query:     63 RLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRY 122
              || . .||||||||| |||   |.|||||..|| ..||||||||| |||.||.|||||||
Sbjct: 137515 RLSNGEGDGAWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRY 137336

Query:    123 SRDGRRWMGWKDRWGQEVIS 142
              ||||| || ||||||||| .
Sbjct: 137335 SRDGRHWMTWKDRWGQEVFT 137276

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  132 bits (332), Expect = 5e-029
 Identities = 61/79 (77%), Positives = 72/79 (91%)
 Frame = +2

Query:    702 SYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYR 761
              ||  |...|.||.|||.||..|||||||||||||||| |  ||||||||||||| |||||
Sbjct: 150833 SYGTLINMASQISSGMKYLSSLNFVHRDLATRNCLVGMNNIIKIADFGMSRNLYRGDYYR 151012

Query:    762 VQGRAVLPIRWMAWECILM 780
              .|||||||||||.|| ||.
Sbjct: 151013 IQGRAVLPIRWMSWESILL 151069

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  129 bits (324), Expect = 4e-028
 Identities = 58/75 (77%), Positives = 69/75 (92%)
 Frame = +2

Query:   706 LLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGR 765
             |||.. ||.|||.|||.||||||||||||||.  . ||||.|||||||||. ||||.|||
Sbjct: 82673 LLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYRIQGR 82852

Query:   766 AVLPIRWMAWECILM 780
             ||||||||||| ||.
Sbjct: 82853 AVLPIRWMAWESILL 82897

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  108 bits (269), Expect = 9e-022
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = -1

Query:     63 RLESSDGDGAWCPAGSVFPKE-EEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLR 121
              ||.  .|||||||     |.  .|.||.||. || . |||||||||||.| ||...|...
Sbjct: 673734 RLDCEEGDGAWCPEIPAEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIK 673555

Query:    122 YSRDGRRWMGWKDRWGQEVISGNEDP 147
              ||||| ||. |..| |.||      |
Sbjct: 673554 YSRDGSRWISWRNRQGKEVHD....P 673477

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  102 bits (254), Expect = 5e-020
 Identities = 45/79 (56%), Positives = 60/79 (75%), Gaps = 1/79 (1%)
 Frame = +3

Query:     63 RLESSDGDGAWCP-AGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLR 121
              ||.  ||||||||   .     .|.||.||. || | ||||||||| |.| ||.. ||..
Sbjct: 133020 RLDFDDGDGAWCPDVMAEAHSLKEFLQIDLRTLHFVTLVGTQGRHADGVGNEFAQRYRIK 133199

Query:    122 YSRDGRRWMGWKDRWGQEV 140
              ||||| ||. |.|| |..|
Sbjct: 133200 YSRDGTRWVSWRDRQGRQV 133256

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  99 bits (245), Expect = 6e-019
 Identities = 43/55 (78%), Positives = 52/55 (94%)
 Frame = +1

Query:    629 RNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED 683
              ||||.||..|.|||.|||||||| |||. |||||||.|||||||||||| |||..
Sbjct: 148975 RNDFMKEIRIISRLRDPNIIRLLAVCVESDPLCMITEYMENGDLNQFLSRHQLQE 149139

>Zv7_masked||Zv7_scaffold1620 |chr16|Len:865587|start:42338361|end:43203947

          Length = 865587

 Score =  99 bits (244), Expect = 7e-019
 Identities = 44/63 (69%), Positives = 55/63 (87%)
 Frame = -1

Query:    701 ISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYY 760
              .. | .||.|||||||| |||.|.|||||||||||||||   .|| ||||||..|. |||
Sbjct: 346902 LTLPQMLHIAAQIASGMVYLASLHFVHRDLATRNCLVGEGLVVKIGDFGMSRDIYSTDYY 346723

Query:    761 RVQ 763
              ||.
Sbjct: 346722 RVK 346714

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  98 bits (243), Expect = 1e-018
 Identities = 41/79 (51%), Positives = 58/79 (73%)
 Frame = +1

Query:    63 RLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRY 122
             ||   .|.|||| || . | . .|||.||..|  . .| ||||.|   | ||.| ||| |
Sbjct: 35236 RLNREEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEY 35415

Query:   123 SRDGRRWMGWKDRWGQEVI 141
             |||| ||. |..|.| ||.
Sbjct: 35416 SRDGHRWISWRNRFGNEVL 35472

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  98 bits (243), Expect = 1e-018
 Identities = 45/54 (83%), Positives = 49/54 (90%)
 Frame = -1

Query:    629 RNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLE 682
              |||||||.||||||||||||||| ||.  |||||||.|||||||||||| |. |
Sbjct: 657636 RNDFLKEIKIMSRLKDPNIIRLLAVCMSSDPLCMITEYMENGDLNQFLSRHEPE 657475

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  98 bits (242), Expect = 1e-018
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = -2

Query:   587 VHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPN 646
             ||   | . |    |    |..   ||||   .     .   ||||||||||.|||||||
Sbjct: 94649 VHYIIVPNNQIFCILQNCNNLKMSFPLLV---LPSHSCSCVNRNDFLKEVKILSRLKDPN 94479

Query:   647 IIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDK 684
             |||||||||  |||||.|.|||.|||||.||   | ||
Sbjct: 94478 IIRLLGVCVSSDPLCMVTEYMESGDLNQYLSHRVLLDK 94365

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  96 bits (238), Expect = 4e-018
 Identities = 42/53 (79%), Positives = 49/53 (92%)
 Frame = -3

Query:   781 GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYL 833
             ||||||||||||||||||.| .|. ||.  .||||||.|||||||||||||.|
Sbjct: 92302 GKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDQGRQVHL 92144

>Zv7_masked||Zv7_scaffold474 |chr5|Len:2619322|start:49018611|end:51637932

          Length = 2619322

 Score =  94 bits (233), Expect = 1e-017
 Identities = 42/62 (67%), Positives = 53/62 (85%)
 Frame = +3

Query:    701 ISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYY 760
              .. | .||.| |||.|| |||. .||||||||||||||||  .|| ||||||..|. |||
Sbjct: 186624 LTQPQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYY 186803

Query:    761 RV 762
              ||
Sbjct: 186804 RV 186809

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  94 bits (232), Expect = 2e-017
 Identities = 41/55 (74%), Positives = 48/55 (87%)
 Frame = -2

Query:    778 ILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVY 832
              .| |||||.||||||||||||.|  |. ||. ||.||||||| ||||||| |||.
Sbjct: 653618 VLQGKFTTSSDVWAFGVTLWEMLTFCKEQPYSQLSDEQVIENTGEFFRDQRRQVH 653454

>Zv7_masked||Zv7_scaffold799 |chr8|Len:108633|start:33709931|end:33818563

          Length = 108633

 Score =  92 bits (226), Expect = 9e-017
 Identities = 41/63 (65%), Positives = 53/63 (84%)
 Frame = -2

Query:   701 ISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYY 760
             ..   .||.| |||.|| |||. .||||||||||||||||  .|| ||||||..|. |||
Sbjct: 71819 LTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYY 71640

Query:   761 RVQ 763
             ||.
Sbjct: 71639 RVR 71631

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  91 bits (225), Expect = 1e-016
 Identities = 40/51 (78%), Positives = 44/51 (86%)
 Frame = +2

Query:    781 GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV 831
              |||| |||||||||||||.| ||. ||. | |||||||| ||||||| .||
Sbjct: 153041 GKFTMASDVWAFGVTLWEILTLCKEQPYAQFTDEQVIENTGEFFRDQNKQV 153193

>Zv7_masked||Zv7_NA778 |chrNA|Len:33397

          Length = 33397

 Score =  91 bits (224), Expect = 2e-016
 Identities = 40/51 (78%), Positives = 45/51 (88%)
 Frame = -1

Query: 781 GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV 831
           ||||||||||||||||||.  ||. ||.  |.||||||| |||||.|||||
Sbjct: 898 GKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQV 746

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  91 bits (224), Expect = 2e-016
 Identities = 40/51 (78%), Positives = 45/51 (88%)
 Frame = +3

Query:   781 GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV 831
             ||||||||||||||||||.  ||. ||.  |.||||||| |||||.|||||
Sbjct: 85311 GKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQV 85463

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  89 bits (220), Expect = 4e-016
 Identities = 40/54 (74%), Positives = 47/54 (87%)
 Frame = +1

Query:   629 RNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLE 682
             |||||||.|||||| .||||.|| |||  |||||.|.|||||||| |||  ..|
Sbjct: 79849 RNDFLKEIKIMSRLNNPNIIQLLCVCVSSDPLCMVTEYMENGDLNMFLSQREIE 80010

>Zv7_masked||Zv7_scaffold2424 |chr25|Len:459853|start:7008836|end:7468688

          Length = 459853

 Score =  88 bits (216), Expect = 1e-015
 Identities = 39/58 (67%), Positives = 49/58 (84%)
 Frame = +3

Query:    706 LLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ 763
              .||.|.|||||| || . .||||||||||||||    .|| ||||||..|. |||||.
Sbjct: 375246 MLHIASQIASGMVYLGSQHFVHRDLATRNCLVGNGLLVKIGDFGMSRDIYSTDYYRVR 375419

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  87 bits (214), Expect = 2e-015
 Identities = 37/50 (74%), Positives = 46/50 (92%)
 Frame = -1

Query:    139 EVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWR 188
              .|.||||.   .||||||||..||.||||| ||||||||||||||||.|.
Sbjct: 137205 QVVSGNENTYDIVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWK 137056

>Zv7_masked||Zv7_scaffold476 |chr5|Len:492374|start:52222926|end:52715299

          Length = 492374

 Score =  87 bits (214), Expect = 2e-015
 Identities = 38/57 (66%), Positives = 48/57 (84%)
 Frame = +1

Query:    706 LLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRV 762
              .||.| |||.|| ||.. .||||||||||||||    .|| ||||||..|. |||||
Sbjct: 321748 MLHIATQIAAGMVYLSSQHFVHRDLATRNCLVGNGLLVKIGDFGMSRDIYSSDYYRV 321918

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  85 bits (209), Expect = 8e-015
 Identities = 38/43 (88%), Positives = 40/43 (93%)
 Frame = -1

Query:   743 IKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTT 785
             |||||||||||||||||||.|||||||||||||||||| .  |
Sbjct: 92706 IKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMVRMQT 92578

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  83 bits (204), Expect = 3e-014
 Identities = 36/54 (66%), Positives = 43/54 (79%)
 Frame = +1

Query:   232 ADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
             |||||||||| .|.. |.||||||||| |     |||||||.||| | | .|.|
Sbjct: 44995 ADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPGYVEMEFQFDRQRNFTSMKV 45156

>Zv7_masked||Zv7_NA491 |chrNA|Len:10155

          Length = 10155

 Score =  81 bits (198), Expect = 2e-013
 Identities = 35/54 (64%), Positives = 42/54 (77%)
 Frame = -2

Query:  232 ADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
            |||||||||| .|.. |.||||||||| |      ||||||.||| | | .|.|
Sbjct: 9185 ADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKV 9024

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  80 bits (197), Expect = 2e-013
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 1/59 (1%)
 Frame = -2

Query:   531 HYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHL 589
             |||||||..||||.| ||||||||      | ||  . || || ||||||||||||| |
Sbjct: 95921 HYAEADIISLQGVSGNNTYAVPAL-SATPTDCPPLPELPRERLVFKEKLGEGQFGEVQL 95748

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  78 bits (190), Expect = 1e-012
 Identities = 34/53 (64%), Positives = 39/53 (73%)
 Frame = -2

Query:    233 DGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
              ||. |||||  |    ||||||||||.| || .||||. ||||| | |  |.|
Sbjct: 666536 DGMCGLDDFTLSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKV 666378

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  77 bits (187), Expect = 3e-012
 Identities = 34/43 (79%), Positives = 40/43 (93%)
 Frame = -1

Query:   587 VHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNAR 629
             |||||...|||| .|.|| ||||| |||||||||||||.||||
Sbjct: 95613 VHLCEIENPQDLANLEFPFNVRKGRPLLVAVKILRPDASKNAR 95485

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  76 bits (185), Expect = 5e-012
 Identities = 35/53 (66%), Positives = 39/53 (73%)
 Frame = +3

Query:    233 DGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
              ||  ||||| |||   ||||||||||.| |   | ||| |||||.| | .|.|
Sbjct: 135690 DGSWGLDDFTKSQVYGVWPGYDYVGWTNASLPGGSVEMTFEFDRVRNFTSMKV 135848

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  75 bits (184), Expect = 7e-012
 Identities = 42/115 (36%), Positives = 51/115 (44%), Gaps = 1/115 (0%)
 Frame = -3

Query:    284 QVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVA 343
              ||| || || | |.   | |.|.      |  ||       .| |  .| .|.||||| |
Sbjct: 110170 QVHSNNRHTQGVRVFSEVVCKFKASLLSPW-AEPELSLQVSDLHDLSSRTISLPLGGRPA 109994

Query:    344 RFLQCRFLFAGPWLLFSEISFISDVVNNSSPALGGTFXXXXXXXXXXXXTNFSSL 398
              . |.| | ||  ||| |||||                            |  |||
Sbjct: 109993 QILRCHFAFADNWLLISEISF...........................LTFRSSL 109829

>Zv7_masked||Zv7_scaffold835 |chr8|Len:243529|start:48150984|end:48394512

          Length = 243529

 Score =  75 bits (182), Expect = 1e-011
 Identities = 39/80 (48%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = +3

Query:    715 SGMRYLATLNF----VHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPI 770
              | .|.. || |    . |||| ||||||||  .|.||||.|| |  || |     |  ||
Sbjct: 240150 SNLRFMLTLIFILHLILRDLAARNCLVGENHVVKVADFGLSR-LMTGDTYTAHAGAKFPI 240326

Query:    771 RWMAWECILMGKFTTASDVW 790
              .| | | .    |.  ||||
Sbjct: 240327 KWTAPESLAYNTFSIKSDVW 240386

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  74 bits (181), Expect = 1e-011
 Identities = 42/93 (45%), Positives = 53/93 (56%), Gaps = 2/93 (2%)
 Frame = -3

Query:    284 QVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVA 343
              ||| || || | |.   | |.|.      |  ||       .| |  .| .|.||||| |
Sbjct: 128290 QVHSNNRHTQGVRVFSEVVCKFKASLLSPW-AEPELSLQVSDLHDLSSRTISLPLGGRPA 128114

Query:    344 RFLQCRFLFAGPWLLFSEISFISDVVNNSSPAL 376
              . |.| | ||  ||| ||||| |  .|  .| |
Sbjct: 128113 QILRCHFAFADNWLLISEISFYSS-MNTHTPDL 128018

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  74 bits (181), Expect = 1e-011
 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Frame = -2

Query:    531 HYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRV-DFPRSRLRFKEKLGEGQFGEV 587
              |||||||| |||||||||||||||    .      | .| |  | |||||||||||||
Sbjct: 661505 HYAEADIVNLQGVTGGNTYAVPALTMDLLSGKDVAVEEFSRKLLTFKEKLGEGQFGEV 661332

>Zv7_masked||Zv7_scaffold502 |chr5|Len:204373|start:63329117|end:63533489

          Length = 204373

 Score =  74 bits (180), Expect = 2e-011
 Identities = 37/87 (42%), Positives = 51/87 (58%)
 Frame = +3

Query:   280 FQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLG 339
             |   ||| ||| ..| ..   | | |.      || ||.  .   .  .| || |..|| 
Sbjct: 49962 FSVYQVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVIDDRNPSARYVTIPLK 50141

Query:   340 GRVARFLQCRFLFAGPWLLFSEISFIS 366
              | |  |.||| ||  |..|||||| |
Sbjct: 50142 HRSATALRCRFYFADTWMMFSEISFQS 50222

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  73 bits (178), Expect = 3e-011
 Identities = 31/47 (65%), Positives = 37/47 (78%)
 Frame = -3

Query:   830 QVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV 876
             |||||||  |||||||||| ||.|. . || |. .| || |||.| |
Sbjct: 92074 QVYLSRPAVCPQGLYELMLSCWNRDCKLRPSFAYIHSFLTEDAMNMV 91934

>Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:12182318

          Length = 2644218

 Score =  72 bits (175), Expect = 7e-011
 Identities = 35/68 (51%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query:     723 LNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGK 782
               |. . |||| ||||||||  .|.||||.|| |  || |     |  ||.| | | .    
Sbjct: 2044574 LHLILRDLAARNCLVGENHVVKVADFGLSR-LMTGDTYTAHAGAKFPIKWTAPESLAYNT 2044750

Query:     783 FTTASDVW 790
               |.  ||||
Sbjct: 2044751 FSIKSDVW 2044774

>Zv7_masked||Zv7_scaffold514 |chr5|Len:269613|start:67199677|end:67469289

          Length = 269613

 Score =  71 bits (173), Expect = 1e-010
 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 1/63 (1%)
 Frame = -1

Query:   728 RDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTAS 787
             |||| ||||||||  .|.||||.|| |  || |     |  ||.| | | .   ||.  |
Sbjct: 39981 RDLAARNCLVGENNLVKVADFGLSR-LMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS 39805

Query:   788 DVW 790
             |||
Sbjct: 39804 DVW 39796

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  70 bits (169), Expect = 4e-010
 Identities = 29/53 (54%), Positives = 39/53 (73%)
 Frame = -2

Query:    233 DGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
              |||.| .|| .|.|||||||||||||.  .     |..|| |.. | |  |||
Sbjct: 134978 DGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQV 134820

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  70 bits (169), Expect = 4e-010
 Identities = 29/53 (54%), Positives = 39/53 (73%)
 Frame = -3

Query:    233 DGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQV 285
              |||.| .|| .|.|||||||||||||.  .     |..|| |.. | |  |||
Sbjct: 116794 DGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQV 116636

>Zv7_masked||Zv7_scaffold643 |chr6|Len:1538925|start:50658518|end:52197442

          Length = 1538925

 Score =  66 bits (160), Expect = 4e-009
 Identities = 29/49 (59%), Positives = 36/49 (73%)
 Frame = -3

Query:    139 EVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLW 187
              .|| || .   .||||| ||..|| ||| |  |  |.||.||||||| |
Sbjct: 671845 QVIEGNRNAYDIVLKDLEPPIIARFVRFMPVIDHSMNVCMRVELYGCEW 671699

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  64 bits (154), Expect = 2e-008
 Identities = 29/39 (74%), Positives = 36/39 (92%)
 Frame = -2

Query:   702 SYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGEN 740
             ||| |. .|.||||||..||.||||||||||||||| |.
Sbjct: 92858 SYPALISMASQIASGMKFLASLNFVHRDLATRNCLVEES 92742

>Zv7_masked||Zv7_scaffold103 |chr2|Len:697996|start:3771920|end:4469915

          Length = 697996

 Score =  64 bits (153), Expect = 3e-008
 Identities = 28/48 (58%), Positives = 34/48 (70%)
 Frame = +1

Query:    140 VISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLW 187
              .| || .   .||||| ||..|| ||| |  |  | ||.||||||| |
Sbjct: 133933 IIEGNSNAYDIVLKDLEPPIIARFVRFMPVTDPSMIVCMRVELYGCEW 134076

>Zv7_masked||Zv7_scaffold1332 |chr13|Len:34786|start:52282794|end:52317579

          Length = 34786

 Score =  63 bits (152), Expect = 3e-008
 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +2

Query:  758 DYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVI 817
            .||.  |.  .|.||.  ||.|  .|.. |||||| | .|||  |    |.  |.||||.
Sbjct: 6311 EYYQ-HGQLWIPLRWLPLECVLHREFSSKSDVWAFAVLMWEVFSLADL-PYTHLSDEQVL 6484

Query:  818 ENAGEFFRDQGRQVY----LSRPPACPQGLY 844
            |                  |     |  |||
Sbjct: 6485 EG..............RCSLKYSNTCRFGLY 6577

>Zv7_masked||Zv7_scaffold2250 |chr23|Len:5278691|start:19339444|end:24618134

          Length = 5278691

 Score =  63 bits (152), Expect = 3e-008
 Identities = 30/64 (46%), Positives = 41/64 (64%)
 Frame = -2

Query:    613 LLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDL 672
              .|||.| |.   |.  | ||| |  || .   |||| | ||  .  |. .||..|||| |
Sbjct: 871312 ILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSTPVMIITEFMENGSL 871133

Query:    673 NQFL 676
              . ||
Sbjct: 871132 DSFL 871121

>Zv7_masked||Zv7_scaffold876 |chr8|Len:139946|start:55049087|end:55189032

          Length = 139946

 Score =  63 bits (151), Expect = 4e-008
 Identities = 29/64 (45%), Positives = 42/64 (65%)
 Frame = +3

Query:    613 LLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDL 672
              ..||.| |.   |.  | ||| |  || .   |||||| ||  .  |. ..|..|||| |
Sbjct: 126744 IIVAIKTLKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGAL 126923

Query:    673 NQFL 676
              . ||
Sbjct: 126924 DSFL 126935

>Zv7_masked||Zv7_scaffold1620 |chr16|Len:865587|start:42338361|end:43203947

          Length = 865587

 Score =  62 bits (149), Expect = 8e-008
 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 1/56 (1%)
 Frame = -3

Query:    761 RVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQV 816
              .| || .||||||  | |.  |||| ||.|.||| |||.    . ||. ||.. .|
Sbjct: 344707 QVGGRTMLPIRWMPPESIMYRKFTTESDIWSFGVVLWEIFTYGK-QPWYQLSNSEV 344543

>Zv7_masked||Zv7_scaffold1379 |chr14|Len:188558|start:30529220|end:30717777

          Length = 188558

 Score =  61 bits (146), Expect = 2e-007
 Identities = 29/64 (45%), Positives = 41/64 (64%)
 Frame = -2

Query:   613 LLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDL 672
             | ||.| |.   ..  | ||| |  || .   |||||| ||  .  |. ..|..|||| |
Sbjct: 40873 LYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGAL 40694

Query:   673 NQFL 676
             . ||
Sbjct: 40693 DSFL 40682

>Zv7_masked||Zv7_scaffold1948 |chr20|Len:457866|start:1|end:457866

          Length = 457866

 Score =  60 bits (144), Expect = 3e-007
 Identities = 26/46 (56%), Positives = 35/46 (76%)
 Frame = +2

Query:   707 LHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSR 752
             . . ||.|||| ||   |..||||| || |||.|   |.||||..|
Sbjct: 20084 IDMGAQVASGMAYLELQNYIHRDLAARNVLVGDNNVCKVADFGLAR 20221

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0