BLASTP 7.6.0


Query=uc003rcs |6_cox_hap1|AJ504716|Q9H633-3|Q9H633-3|RPP21|NA|NA|Ribonuclease
       P protein subunit p21 (EC 3.1.26.5) (RNaseP protein p21)
       (Ribonucleoprotein V)
        (144 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|en...     60   1e-008

>Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|end:11845734

          Length = 770644

 Score =  60 bits (143), Expect = 1e-008
 Identities = 26/35 (74%), Positives = 33/35 (94%)
 Frame = -2

Query:     19 QAAHCVLAQDPENQALARFYCYTERTIAKRLVLRR 53
              .||||||||.|||  ||||||.|..||.||||||.
Sbjct: 391755 KAAHCVLAQNPENIELARFYCFTQKTISKRLVLRQ 391651

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0