BLASTP 7.6.0


Query=uc003rcr
       |6_cox_hap1|NM_024839|Q9H633|RPP21_HUMAN|RPP21|NM_024839|NP_079115|ribon
       uclease P 21kDa subunit
        (154 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|en...     60   2e-008
Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|en...     44   0.001

>Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|end:11845734

          Length = 770644

 Score =  60 bits (143), Expect = 2e-008
 Identities = 26/35 (74%), Positives = 33/35 (94%)
 Frame = -2

Query:     19 QAAHCVLAQDPENQALARFYCYTERTIAKRLVLRR 53
              .||||||||.|||  ||||||.|..||.||||||.
Sbjct: 391755 KAAHCVLAQNPENIELARFYCFTQKTISKRLVLRQ 391651

>Zv7_masked||Zv7_scaffold2169 |chr22|Len:770644|start:11075091|end:11845734

          Length = 770644

 Score =  44 bits (101), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = -3

Query:     88 TVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQ 121
              ||  ||.|  ..|| |.| | || |.||||| .|
Sbjct: 391223 TVVRCLSCGLTKRFPNNPKHKLWVDQPEAQLENQ 391122

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0