BLASTP 7.6.0


Query=uc003rcm
       |6_cox_hap1|BC053512|Q9HCM9-2|Q9HCM9-2|TRIM39|NM_172016|NP_742013|tripar
       tite motif-containing 39 isoform 2
        (488 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    188   4e-046
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...    182   3e-044
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    181   5e-044
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    181   7e-044
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    174   5e-042
Zv7_masked||Zv7_scaffold291 |chr3|Len:812120|start:57170238|end:...    173   2e-041
Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:...    171   7e-041
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...    166   2e-039
Zv7_masked||Zv7_scaffold703 |chr7|Len:3579684|start:19190852|end...    166   2e-039
Zv7_masked||Zv7_scaffold78 |chr1|Len:1166935|start:54488721|end:...    166   2e-039
Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|en...    160   1e-037
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    158   5e-037
Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:...    158   5e-037
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...    157   8e-037
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    156   1e-036
Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    155   3e-036
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    154   5e-036
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    151   8e-035
Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:...    151   8e-035
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...    149   3e-034
Zv7_masked||Zv7_scaffold1164 |chr12|Len:2996289|start:19901072|e...    148   5e-034
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    148   7e-034
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    148   7e-034
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    146   1e-033
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    145   4e-033
Zv7_masked||Zv7_scaffold267 |chr3|Len:678050|start:48334169|end:...    144   1e-032
Zv7_masked||Zv7_scaffold446 |chr5|Len:3556776|start:11238757|end...    143   1e-032
Zv7_masked||Zv7_NA211 |chrNA|Len:47979                                 143   2e-032
Zv7_masked||Zv7_scaffold1025 |chr10|Len:919371|start:36202715|en...    141   5e-032
Zv7_masked||Zv7_scaffold1572 |chr16|Len:1454232|start:5719242|en...    130   1e-028
Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end...    127   1e-027
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    122   4e-026
Zv7_masked||Zv7_scaffold1365 |chr14|Len:2230408|start:9926351|en...    121   7e-026
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...    117   1e-024
Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:...    117   1e-024
Zv7_masked||Zv7_scaffold1787 |chr18|Len:760096|start:5272124|end...    116   2e-024
Zv7_masked||Zv7_scaffold280 |chr3|Len:181614|start:51916320|end:...    112   4e-023
Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:...    110   1e-022
Zv7_masked||Zv7_scaffold2122 |chr21|Len:25789|start:44468724|end...    107   1e-021
Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|e...    101   9e-020
Zv7_masked||Zv7_scaffold221 |chr3|Len:298820|start:1455821|end:1...    100   2e-019
Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:...     96   2e-018
Zv7_masked||Zv7_scaffold2612 |chrUn|Len:171859                          93   2e-017
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     93   2e-017
Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end...     93   2e-017
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...     88   5e-016
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     88   6e-016
Zv7_masked||Zv7_scaffold2286 |chr23|Len:202071|start:41683726|en...     87   8e-016
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     87   1e-015
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     87   1e-015
Zv7_masked||Zv7_scaffold331 |chr4|Len:771400|start:828519|end:15...     86   2e-015
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     86   2e-015
Zv7_masked||Zv7_scaffold160 |chr2|Len:160001|start:44916556|end:...     84   9e-015
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     84   9e-015
Zv7_masked||Zv7_scaffold284 |chr3|Len:334356|start:53561975|end:...     84   9e-015
Zv7_masked||Zv7_scaffold2428 |chr25|Len:2904654|start:7858903|en...     84   1e-014
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     83   2e-014
Zv7_masked||Zv7_scaffold311 |chr3|Len:276465|start:61512878|end:...     83   2e-014
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     82   3e-014
Zv7_masked||Zv7_scaffold311 |chr3|Len:276465|start:61512878|end:...     80   1e-013
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...     80   1e-013
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     80   2e-013
Zv7_masked||Zv7_scaffold2208 |chr22|Len:182503|start:35331637|en...     77   1e-012
Zv7_masked||Zv7_scaffold2218 |chr22|Len:302853|start:38520126|en...     77   1e-012
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     71   6e-011
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     71   6e-011
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     70   1e-010
Zv7_masked||Zv7_scaffold144 |chr2|Len:1864304|start:37313699|end...     70   1e-010
Zv7_masked||Zv7_scaffold2390 |chr24|Len:154428|start:39580998|en...     70   1e-010
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     70   2e-010
Zv7_masked||Zv7_scaffold157 |chr2|Len:1011486|start:42600752|end...     69   2e-010
Zv7_masked||Zv7_scaffold163 |chr2|Len:712665|start:45269899|end:...     69   2e-010
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     69   4e-010
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     68   5e-010
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     67   9e-010
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...     67   1e-009
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     67   1e-009
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     67   2e-009
Zv7_masked||Zv7_scaffold902 |chr9|Len:646172|start:3746856|end:4...     67   2e-009
Zv7_masked||Zv7_scaffold106 |chr2|Len:1706504|start:6785195|end:...     66   2e-009
Zv7_masked||Zv7_scaffold157 |chr2|Len:1011486|start:42600752|end...     66   2e-009
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     66   2e-009
Zv7_masked||Zv7_scaffold147 |chr2|Len:400957|start:39394084|end:...     66   3e-009
Zv7_masked||Zv7_scaffold177 |chr2|Len:309133|start:48742203|end:...     66   3e-009
Zv7_masked||Zv7_scaffold144 |chr2|Len:1864304|start:37313699|end...     65   4e-009
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...     65   4e-009
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...     65   6e-009
Zv7_masked||Zv7_scaffold157 |chr2|Len:1011486|start:42600752|end...     65   6e-009
Zv7_masked||Zv7_scaffold846 |chr8|Len:1051471|start:51141559|end...     64   7e-009
Zv7_masked||Zv7_scaffold846 |chr8|Len:1051471|start:51141559|end...     64   1e-008
Zv7_masked||Zv7_scaffold1005 |chr10|Len:2653080|start:19235089|e...     64   1e-008
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     64   1e-008
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...     64   1e-008
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...     63   2e-008
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...     63   2e-008
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     63   2e-008
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...     62   3e-008
Zv7_masked||Zv7_scaffold1903 |chr19|Len:162695|start:33544340|en...     62   3e-008
Zv7_masked||Zv7_scaffold236 |chr3|Len:3593183|start:14632275|end...     62   3e-008
Zv7_masked||Zv7_scaffold1981 |chr20|Len:4174062|start:25147528|e...     62   4e-008

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  188 bits (476), Expect = 4e-046
 Identities = 94/185 (50%), Positives = 130/185 (70%), Gaps = 3/185 (1%)
 Frame = -3

Query:    300 KILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFT 359
              .||  |  ..|.||.|||| |.||.||| |. |.    .||| | || . | ||| |||.
Sbjct: 447144 RILFSLSVELTMDPDTAHPELLLSDDRKQVR-VQDVEHELPDIPERFDYCPDVLAKEGFS 446968

Query:    360 SGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPL 419
              .|| |.||.|  || | ||| |.|..||||.|  |. |.| | | |  .| | | |   |
Sbjct: 446967 AGRFYFEVQVKGKTDWVVGVARESINRKGEITVNPQNGFWAVGLRNESEYKACTGPAVSL 446788

Query:    420 HIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAP 478
               ..|||..||.|.||| | .|||.|  |||||.|   .||||..| | | .  | .|  |
Sbjct: 446787 SLRVKPQKVGVFVDYEEGLVSFYDVESRSHIYSFIGQSFTEKVYPFFSPEVIEGGQN-PP 446611

Query:    479 LTIRP 483
              | | |
Sbjct: 446610 LIISP 446596

>Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end:19142321

          Length = 6199740

 Score =  182 bits (460), Expect = 3e-044
 Identities = 94/178 (52%), Positives = 119/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query:     308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
               .||.||||||| | |||| |  .| ||| . .|| | ||   | ||  ||| ||. |.||
Sbjct: 1919449 NVTMDPETAHPKLFLSEDDKQAEFGETR-QPVPDNPWRFNKCPSVLGKEGFCSGKFYFEV 1919273

Query:     368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
               .|  || | .|| |.||.||| .|  |  | | . | || .| |       | .||||. 
Sbjct: 1919272 QVKGKTEWDLGVARESVNRKGIITLSPRNGLWTLWLRNGAEYKACDCLSVSLCLKVKPQT 1919093

Query:     428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRPP 484
               ||.|.||| | .|||.|   ||||.||  .|||||.| | ||   | .|. || | ||
Sbjct: 1919092 VGVFVDYEEGLVSFYDVESMSHIYSFTGQSFTEKLYPYFSPGFNNGDQNSDPLIISPP 1918919

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  181 bits (458), Expect = 5e-044
 Identities = 92/178 (51%), Positives = 122/178 (68%), Gaps = 2/178 (1%)
 Frame = -3

Query:     305 LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
               |  ||||||.||||.|..|.. | |   .  | .| | | ||   ||||| ||| ||  |
Sbjct: 2786187 LSVDVTLDPDTAHPDLIISDNEKQVTDGDIEL-ELLDNPGRFDTCPCVLAKEGFNSGIFY 2786011

Query:     365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVK 424
               .||.| .|| | .|| |.|. |||..|  || ||| . | ||..| |  .    | ..||
Sbjct: 2786010 FEVQVKEKTDWNLGVVRESIKRKGDITAAPEEGYWIIVLGNGNQYLAIDSSSVSLSLRVK 2785831

Query:     425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTI 481
               |. ||.|.||| | .|||.|   ||||.||  ||||||.| | |      |||||| .
Sbjct: 2785830 PQVVGVFVDYEEGLVSFYDVESGSHIYSFTGQTFTEKLFPFFSPCNNQKGKNAAPLIL 2785657

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  181 bits (457), Expect = 7e-044
 Identities = 93/177 (52%), Positives = 121/177 (68%), Gaps = 2/177 (1%)
 Frame = +3

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              ||||||.||.| |.||.| | |.  .   ..||| |.||  |  ||  |||.||| |.||
Sbjct: 124731 DVTLDPDTANPYLILSDDGKQVRCGDIE-QELPDKPQRFDKYEDVLGKEGFSSGRFYYEV 124907

Query:    368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
              .|  || | .|| |.|| ||||.|  |  ||| | | ||..|         | .||||.|
Sbjct: 124908 QVKKKTDWTLGVVRESVDRKGEITLSPGNGYWTVWLRNGNEYKFCADSPVSLSLKVKPQR 125087

Query:    428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
              ||.|.||| | .|||.|   ||||..|  |||.||.| | |      ||.||| | |
Sbjct: 125088 VGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEDNDDGKNSAPLIITP 125258

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  174 bits (441), Expect = 5e-042
 Identities = 91/177 (51%), Positives = 118/177 (66%), Gaps = 2/177 (1%)
 Frame = +3

Query:   308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
             ||||||.||.| |.|||| | |   . | . ||| |.||  |  ||  |||.||| |.||
Sbjct: 68988 DVTLDPDTANPYLILSEDGKQVTCGDIR-QKLPDKPQRFDIYLDVLGKEGFSSGRFYYEV 69164

Query:   368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
             .|  || | .|| |.|| ||||.   |  |.| | | .|..| |       | .||| .|
Sbjct: 69165 QVKGKTDWTLGVVRESVDRKGEVIHSPSDGFWTVILGDGNEYEANADSPVSLSVKVKLQR 69344

Query:   428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
             ||.|.||| | .|||.|   ||||..|  |||.||.| | | |    ||.  | | |
Sbjct: 69345 VGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEINDNGKNSTSLIITP 69515

>Zv7_masked||Zv7_scaffold291 |chr3|Len:812120|start:57170238|end:57982357

          Length = 812120

 Score =  173 bits (436), Expect = 2e-041
 Identities = 84/174 (48%), Positives = 113/174 (64%), Gaps = 1/174 (0%)
 Frame = +2

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              || |.| |||  | .||||| |.    . ...|. |.||     |.. | |  ||| |||
Sbjct: 720992 DVNLNPRTAHAYLYISEDRKEVRHA-NKQQEVPENPKRFDRVINVMSKEAFRYGRHLWEV 721168

Query:    368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
              .||||| | .|| . ||.|||. |  |  |.| . | || .| | | | |  ..  ||||
Sbjct: 721169 DVGDKTDWDLGVAKQSVNRKGKFTICPSNGFWTLSLKNGSQYVANTYPPTSFNLSHKPKR 721348

Query:    428 VGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTI 481
              | |.|||. | .|||     .|||.| |.||.|| |.  ||   | || ||| |
Sbjct: 721349 VSIYLDYDEGRVSFYCSDTGTHIYSFRDSFTDKLHPILSPGRPHGEKNTAPLII 721510

>Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:63261841

          Length = 347926

 Score =  171 bits (431), Expect = 7e-041
 Identities = 89/181 (49%), Positives = 117/181 (64%), Gaps = 2/181 (1%)
 Frame = +3

Query:    302 LKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDL-PDTPRRFTFYPCVLATEGFTS 360
              |.  . .. ||| ||  .| |||| | |.. | |      ||||||.    ||| |||.|
Sbjct: 260826 LRLSLGELILDPATAQRDLCLSEDGKQVRYEEQRKNSSNSDTPRRFSPALFVLAREGFSS 261005

Query:    361 GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH 420
              |||||||.|| || | ||. | |  ||||.   || |.| . | ||.  | | .    ||
Sbjct: 261006 GRHYWEVDVGHKTAWTVGLARSSARRKGEIRLNPEGGFWCLWLKNGEVKALTGSR-VALH 261182

Query:    421 IKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLT 480
              .   |...||||||||| .|||.|   .|.||| | ||| ..|.| | .    ||  || 
Sbjct: 261183 LTSLPQKLGIFLDYEAGQVSFYDVKTHTHLYTFIDAFTESVYPIFSPCLNQDGKNPGPLV 261362

Query:    481 I 481
              |
Sbjct: 261363 I 261365

>Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end:19142321

          Length = 6199740

 Score =  166 bits (419), Expect = 2e-039
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 2/182 (1%)
 Frame = +3

Query:     305 LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
               |. || |||.|||| |.|||| | |..   .  | | . .||  |  ||  |||.||| |
Sbjct: 2257731 LLVDVILDPDTAHPKLILSEDGKQVRYGNIK-HDRPGSDKRFENYIVVLGKEGFSSGRFY 2257907

Query:     365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVK 424
               .|| |  || | .|| |.|..||||    |  | | . | . .|  |  .    | .|||
Sbjct: 2257908 FEVNVSGKTEWLLGVARESLNRKGEFFLSPNDGNWSLWLKDENKCEACESLTLSLSLKVK 2258087

Query:     425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
               |. ||.|.||| | .|||.|  |||||.||  .|||||.|   |      .|.||| | |
Sbjct: 2258088 PQTVGVFVDYEEGLVSFYDVKSRSHIYSFTGQSFTEKLYPFLSPLSNNKGQNSAPLIISP 2258267

Query:     484 PT 485
                |
Sbjct: 2258268 VT 2258273

>Zv7_masked||Zv7_scaffold703 |chr7|Len:3579684|start:19190852|end:22770535

          Length = 3579684

 Score =  166 bits (418), Expect = 2e-039
 Identities = 82/176 (46%), Positives = 111/176 (63%), Gaps = 1/176 (0%)
 Frame = -3

Query:     308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
               |||||  |||| |.|||..| |   | . . . .   ||    |||  ||| .|||||||
Sbjct: 2725261 DVTLDANTAHPRLILSENKKMVWCSENQ-QHVTNHRERFDRVVCVLGREGFNTGRHYWEV 2725085

Query:     368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
               .|  || | .||   | .|||..   |  ||| . | . . ||  | | | ||.  ||..
Sbjct: 2725084 KVNGKTDWDLGVASHSCNRKGKIKVSPSHGYWFLSLRDKNNYAFRTEPPTVLHLSNKPQK 2724905

Query:     428 VGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
               .|.|.||| | .|||.|  . ||.|| | |.| ..| | |      || ||| | |
Sbjct: 2724904 MGLFVDYEKGQVSFYDVDAKMHIHTFMDNFSETIYPFFSPCTNKNSKNEAPLVITP 2724737

>Zv7_masked||Zv7_scaffold78 |chr1|Len:1166935|start:54488721|end:55655655

          Length = 1166935

 Score =  166 bits (418), Expect = 2e-039
 Identities = 81/180 (45%), Positives = 111/180 (61%), Gaps = 1/180 (0%)
 Frame = +3

Query:     305 LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
               |  ||||| ..||| ||.||| | |     | ...|||  ||    |||  .|  || ||
Sbjct: 1138476 LPVDVTLDKDSAHPRLVISEDGKQV-LCSDRYQNVPDTLERFDRVVCVLGRQGINSGCHY 1138652

Query:     365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVK 424
               ||| | ||| | .|.   ...|||..   |  |.| . | .   |   | | ||. .  |
Sbjct: 1138653 WEVLVSDKTDWDLGIAARTINRKGKIAANPANGFWFLSLRDKQDYVFRTEPSTPIIVNPK 1138832

Query:     425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPP 484
               |.|. . .||| | |||||   .. |.|.||.|.| |.| | |      || ||| | ||
Sbjct: 1138833 PQRITVSVDYERGQLSFYNADTKTLIFTYTDSFSETLYPFFSPCTNKSGKNEAPLIICPP 1139012

>Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|end:45582455

          Length = 159641

 Score =  160 bits (404), Expect = 1e-037
 Identities = 81/177 (45%), Positives = 110/177 (62%), Gaps = 2/177 (1%)
 Frame = -3

Query:   308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
             ||||||.||.| |.||.| | |   .    |.|. | || .   ||  .|| ||. |.||
Sbjct: 27957 DVTLDPDTANPFLILSDDEKQVSHGDIEY-DVPEIPERFDYTVSVLGKQGFNSGKFYYEV 27781

Query:   368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
             .|  |  | .|| |.|.|||      |  |.| . | | ..|     |      . ||..
Sbjct: 27780 QVKGKKEWDLGVARESISRKETNQLTPANGFWTMALINENEYLICDDPVVSFPQRAKPEK 27601

Query:   428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
             ||.|.||| | .||||| | ||||.||  |||| |.| | | .    ||. || | |
Sbjct: 27600 VGVFVDYEEGLVSFYNVNDGSHIYSFTAQTFTETLYPYFSPCLNDDGKNSKPLIITP 27430

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  158 bits (398), Expect = 5e-037
 Identities = 77/146 (52%), Positives = 102/146 (69%), Gaps = 2/146 (1%)
 Frame = +3

Query:   339 LPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGY 398
             ||| |.||   ||||  |||.||  |.||.|  || | .|| |.|..||||.|  |  |.
Sbjct: 86565 LPDKPQRFDRCPCVLGKEGFSSGGFYFEVQVKGKTDWTLGVVRESINRKGEITLTPSNGF 86744

Query:   399 WRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTF 457
             | | |   ..| |  .|  || .||| .|||.|.||| | .|||.|   ||||..|  ||
Sbjct: 86745 WTVWL-RKNEYKALASPSVPLSLKVKLQRVGVFVDYEEGLVSFYDVESSSHIYSYTGQTF 86921

Query:   458 TEKLWPLFYPGIRAGRKNAAPLTIRP 483
             |.||.| | ||.  | ||. || | |
Sbjct: 86922 TDKLYPYFSPGLNHGGKNSNPLIITP 86999

>Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:63261841

          Length = 347926

 Score =  158 bits (398), Expect = 5e-037
 Identities = 75/161 (46%), Positives = 107/161 (66%), Gaps = 1/161 (0%)
 Frame = +2

Query:    306 IADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYW 365
              . ||| ||.||.| | ||||   .. . .  .|| | | ||      |  .|| ||| ||
Sbjct: 273251 VVDVTFDPDTANPWLQLSEDGHQIRHLGS-WQDLRDAPERFDTVVIALGRQGFCSGRRYW 273427

Query:    366 EVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKP 425
              ||.||.|  | .|| | ||.||| ..     ||| . .  | .|  ...|   . .. | 
Sbjct: 273428 EVQVGEKDDWYLGVARGSVNRKGRISVSTTQGYWALAMKKGQEYRVSSSPPLLVSVEHKL 273607

Query:    426 KRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
              ||||...||| | .|||.| ..|||||| ||| |||.| ||
Sbjct: 273608 KRVGVYVDYEEGQVSFYDVQNKSHIYTFMDTFKEKLFPFFY 273730

>Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end:19142321

          Length = 6199740

 Score =  157 bits (396), Expect = 8e-037
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = +3

Query:     305 LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
               |  || ||| ||.| ||||.. | |    |   |.|. | ||    |||  .||. || |
Sbjct: 3645141 LAVDVILDPNTAYPKLVLSKNGKQVSHGGT-WTDVPNNPERFDTSACVLGKDGFSCGRFY 3645317

Query:     365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVK 424
               .||.| ||  | .|. | |..|||..   || |.| .   ||..| |  .    | .| |
Sbjct: 3645318 FEVQVSDKAEWDLGMARKSINRKGKIKVCPECGFWSIWKRNGNEYVANESSPVWLSLKDK 3645497

Query:     425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTI 481
               |..||.|.||. | .|||||   . ||.||  .| ||..| | |  . |  |. || |
Sbjct: 3645498 PQKVGVFVDYDEGLVSFYNVETEALIYSFTGQSFIEKIYPFFSPCNKRGNTNSKPLII 3645671

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  156 bits (394), Expect = 1e-036
 Identities = 77/184 (41%), Positives = 102/184 (55%), Gaps = 1/184 (0%)
 Frame = +1

Query:   301 ILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTS 360
             ||                                  . |||||.||   ||||  |||.|
Sbjct: 92857 ILY...............................IRQKLPDTPQRFDRCPCVLGKEGFSS 93036

Query:   361 GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH 420
             || |.||.|  || | .|| |.|..||| .|  |  |.| | | ||..| |   |   | 
Sbjct: 93037 GRFYFEVQVKGKTDWTLGVVRESINRKGSITVSPSNGFWTVVLRNGNEYKAFAGPSVSLS 93216

Query:   421 IKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPL 479
             . |  .|||.|.||| | .| |.|   ||||..|  |||.||.| | | .  | ||. ||
Sbjct: 93217 VGVNLQRVGVFVDYEEGLVSIYDVESSSHIYSYTGQTFTDKLYPFFSPHLNNGGKNSNPL 93396

Query:   480 TIRP 483
              | |
Sbjct: 93397 IITP 93408

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  155 bits (391), Expect = 3e-036
 Identities = 79/177 (44%), Positives = 116/177 (65%), Gaps = 4/177 (2%)
 Frame = -3

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              ||||| .||.| |.||.| | .   .   .|||| | ||   | ||  |||..|| |.||
Sbjct: 460341 DVTLDRDTAYPELILSDDGKEMIQGDV-YQDLPDIPERFDHCPSVLGREGFSTGRFYFEV 460165

Query:    368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
              .|  || | .|| |.|..|||..   |. |.| | |  ||.| |   |   |.  |||..
Sbjct: 460164 KVKGKTEWILGVVRESINRKGKIKLSPQDGHWCVALMKGDQYWACADPAVSLN--VKPQK 459991

Query:    428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
              ||.|.||| | . |..|  ||||..||  .|  ...| |     .  |.. || | |
Sbjct: 459990 VGVFVDYEDGLVCFFDVVSRSHIFSFTRQSFINRVYPYFCACFTSNGKHSVPLIISP 459820

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  154 bits (389), Expect = 5e-036
 Identities = 78/184 (42%), Positives = 102/184 (55%), Gaps = 1/184 (0%)
 Frame = +2

Query:   301 ILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTS 360
             ||                                  . ||| |.|| .  |||  |||.|
Sbjct: 78920 ILY...............................IRQKLPDKPQRFDYCVCVLGKEGFSS 79099

Query:   361 GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH 420
             || |.||.|  || | .|| |.|..|||..|     |.| | | || .| |  .|   | 
Sbjct: 79100 GRFYFEVQVKGKTDWDLGVVRESINRKGQITASASKGFWTVVLRNGIEYKACASPPVSLP 79279

Query:   421 IKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPL 479
             .||||.|||.|.||| | . ||.|   ||||.||  |||.|| ||| |      ||. ||
Sbjct: 79280 VKVKPQRVGVFVDYEEGLVLFYDVESSSHIYSFTSQTFTDKLHPLFSPCPNCAGKNSNPL 79459

Query:   480 TIRP 483
              | |
Sbjct: 79460 IITP 79471

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  151 bits (379), Expect = 8e-035
 Identities = 75/149 (50%), Positives = 98/149 (65%), Gaps = 1/149 (0%)
 Frame = +2

Query:    336 LRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPE 395
              .. ||. |.|| .   ||  |||.||| |.||.|  |  | .|| |.|| |||  |  | 
Sbjct: 106760 IQKLPNNPQRFDYSVSVLGKEGFSSGRFYYEVQVKGKIEWELGVARESVGRKGTYTLNPS 106939

Query:    396 TGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT- 454
               |.| | | ||..| | | |   | .||||.|||.|.||| | . ||.    |||..|| 
Sbjct: 106940 NGHWTVVLRNGNEYRACTGPSVSLSLKVKPQRVGVFVDYEEGLVCFYDAESGSHIFSFTG 107119

Query:    455 DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
               ||||||.| | |      ||.||| | |
Sbjct: 107120 QTFTEKLYPFFNPCGHYAGKNSAPLIITP 107206

>Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:12182318

          Length = 2644218

 Score =  151 bits (379), Expect = 8e-035
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              .|. |||||.|.|.|||| | ..    | | .|   |||  . |  |..||.||||||||
Sbjct: 239286 EVSFDPETANPSLLLSEDCKRLQCGLER-RPVPCNLRRFDGWWCCFASQGFSSGRHYWEV 239110

Query:    368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
              ||||.  | .|| ..|   ||      ..||  .||  | .  | | | |||   . |.|
Sbjct: 239109 EVGDR-DWRLGVAKESALCKGYRPLNTQSGYLTLRLERGSELKALTAPTTPLPTTLIPRR 238933

Query:    428 VGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
              ||..|||. | ||||..  |.||||..  |||||.|.|
Sbjct: 238932 VGVYLDYDEGQLSFYDIQKRAHIYTYSQKFTEKLYPVF 238819

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  149 bits (374), Expect = 3e-034
 Identities = 77/169 (45%), Positives = 106/169 (62%), Gaps = 2/169 (1%)
 Frame = +2

Query:    315 TAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTH 374
              ||.| | ||.|  ||    | .. ||| | ||     || ..||.|| | ||||||    
Sbjct: 961994 TAYPCLSLSKDLTSVSNTGT-MQKLPDNPERFDHLVFVLGSKGFSSGCHSWEVEVGKNND 962170

Query:    375 WAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDY 434
              | .|| . ||.|||...  || |.| . | .| .| | ||| | | .    .|| . .||
Sbjct: 962171 WVIGVVKASVARKGKISGCPEGGFWTIALSDG-QYTAMTTPRTQLKLNSHLERVRVKIDY 962347

Query:    435 EAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
              .|| .||..  | . .||||| ||| ..| | ||    | |  || | |
Sbjct: 962348 DAGEVSFFDSVDVAPLYTFTDHFTEMMFPFFCPGANINRNNPGPLKICP 962494

>Zv7_masked||Zv7_scaffold1164 |chr12|Len:2996289|start:19901072|end:22897360

          Length = 2996289

 Score =  148 bits (372), Expect = 5e-034
 Identities = 77/162 (47%), Positives = 102/162 (62%), Gaps = 8/162 (4%)
 Frame = +1

Query:    307 ADVTLDPETAHPNLVLSEDRKSVK--FVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
              |||.||| | .| | .||| | ..   .|    .|| . .||   ||||  ||. |||||
Sbjct: 337021 ADVSLDPMTNNPWLYVSEDHKKIQEGLIEA---NLPYSSQRFDSLPCVLGWEGYMSGRHY 337191

Query:    365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDK-YAATTTPFTPLHIKV 423
              ||||  .  .| |||   |  | |     | .|||   ||   . . | | | |||  ..
Sbjct: 337192 WEVEFANNGYWRVGVTTASSKRHGRFPMNPSSGYW--VLWRSTRQFFACTNPETPLPQEL 337365

Query:    424 KPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
               |.|.||..||| | .||||  ..|||||||  | |||.| |
Sbjct: 337366 VPRRMGIYIDYEEGQISFYNADNKSHIYTFTGHFREKLYPFF 337491

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  148 bits (371), Expect = 7e-034
 Identities = 77/178 (43%), Positives = 105/178 (58%), Gaps = 2/178 (1%)
 Frame = -1

Query:     305 LIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHY 364
               |  ||                   | | .  |. | . | ||   ||||| | |.||| |
Sbjct: 2820665 LSVDV...................VTFGDKELK-LLNNPERFDCCPCVLAKERFSSGRFY 2820489

Query:     365 WEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVK 424
               .||.| .|| | .|| |.|..|||..|  || ||| . | | ..| |  .    | ..||
Sbjct: 2820488 FEVQVKEKTDWDLGVVRESINRKGDITAAPEAGYWIIMLRNENQYLAIDSSSVSLSLRVK 2820309

Query:     425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTI 481
               |. ||.|.||| | ..||.|   | ||.||  ||.||| | | |    | .| ||| |
Sbjct: 2820308 PQVVGVFVDYEEGLVTFYDVESGSFIYSFTGQTFSEKLSPYFSPYQNNGGRNTAPLII 2820135

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  148 bits (371), Expect = 7e-034
 Identities = 78/177 (44%), Positives = 103/177 (58%), Gaps = 2/177 (1%)
 Frame = -3

Query:     306 IADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYW 365
               . ||                     .  | .. ||  |.||     ||| ||| ||. |.
Sbjct: 2808123 LVDV.....................YGAT-VQKLPANPKRFDSCCSVLAKEGFNSGKFYF 2807947

Query:     366 EVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKP 425
               ||.|  || | .|| |.||.||| .|  |  ||| . | || .| |  .|   | .||||
Sbjct: 2807946 EVQVKGKTDWDLGVARESVNRKGTITGSPVNGYWIIVLRNGSQYKARESPTVSLSLKVKP 2807767

Query:     426 KRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTI 481
               . ||.|.||| | .|||.|   | ||.||  ||.||..| | ||     |||||| |
Sbjct: 2807766 QVVGVFVDYEEGLVSFYDVESSSLIYSFTGQTFSEKVFPYFSPGTTNEGKNAAPLII 2807596

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  146 bits (368), Expect = 1e-033
 Identities = 78/177 (44%), Positives = 102/177 (57%), Gaps = 3/177 (1%)
 Frame = +2

Query:   308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
             ||                   |.  |  .. |||  .||    |||  |||.||| |.||
Sbjct: 68546 DV..................QVRLGEI-IQKLPDKSQRFEKCICVLGKEGFSSGRFYFEV 68722

Query:   368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
             .|  || | .|| |.|| ||||.   |  |.| | |   ..| |  .|  || .||| .|
Sbjct: 68723 QVKGKTKWDLGVARESVDRKGEIRLCPSNGFWTVWL-RKNEYKALASPSVPLSVKVKLQR 68899

Query:   428 VGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
             ||.|.||| | .|||.|   ||||.||  |||.||.| | |       |. || | |
Sbjct: 68900 VGVFVDYEEGLVSFYDVESSSHIYSFTGQTFTDKLYPFFNPCSNIDGNNSDPLIITP 69070

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  145 bits (364), Expect = 4e-033
 Identities = 74/148 (50%), Positives = 101/148 (68%), Gaps = 8/148 (5%)
 Frame = +3

Query:    337 RDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPET 396
              ..|||||.|| . ||||  |||.||| |.||.|  || | .|| |.|..|||..|  |  
Sbjct: 105027 QELPDTPQRFDYCPCVLGKEGFSSGRFYYEVQVKGKTDWDLGVARESINRKGKITLTPGN 105206

Query:    397 GYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTD- 455
              |.  | |   ..  .       | .||||.|||.|.||| | .|||.|   ||||.||| 
Sbjct: 105207 GFCTVWLRKENECFS-------LSLKVKPQRVGVFVDYEEGLVSFYDVESSSHIYSFTDQ 105365

Query:    456 TFTEKLWPLFYPGIRAGRKNAAPLTIRP 483
              |||.||.| | |      ||. || | |
Sbjct: 105366 TFTDKLYPYFSPCPNYEGKNSNPLIITP 105449

>Zv7_masked||Zv7_scaffold267 |chr3|Len:678050|start:48334169|end:49012218

          Length = 678050

 Score =  144 bits (361), Expect = 1e-032
 Identities = 72/164 (43%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = +2

Query:    302 LKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSG 361
              .. |  .|||| .||.|.|..||| . ..    |  |.|.  .||  . | . |||| ||
Sbjct: 134903 IRSLTVEVTLDLDTANPDLLISEDERRMRCGFER-SDVPNYHQRFDGWWCAVGTEGFCSG 135079

Query:    362 RHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHI 421
              | ||.|.||.   | .|| ..|  |||  .   .|||  .||  | .  | | ||| |  
Sbjct: 135080 RQYWQVDVGE-MDWRIGVAKESALRKGFKSLNTDTGYLTLRLERGTELKALTVPFTSLPA 135256

Query:    422 KVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
               . |..||..||..   ||||.| .||||||. .|  |||.|||
Sbjct: 135257 TLIPRKVGVYLDFDQSQLSFYDVENRSHIYTYNETPGEKLFPLF 135388

>Zv7_masked||Zv7_scaffold446 |chr5|Len:3556776|start:11238757|end:14795532

          Length = 3556776

 Score =  143 bits (360), Expect = 1e-032
 Identities = 71/161 (44%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = -2

Query:     308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
               |..||| | || | ||.|.| |.   .   ..  . .||  .||||  || ||||.||||
Sbjct: 2407337 DISLDPMTNHPWLQLSDDKKKVQEALSE-TEVSFSKQRFDSWPCVLGWEGLTSGRYYWEV 2407161

Query:     368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDK-YAATTTPFTPLHIKVKPK 426
               .. .| .| .||   |  | |     |  |.| .  |   . . | | | | | . . ||
Sbjct: 2407160 DIANKGYWRIGVTTASSKRHGRSPMNPSEGFWTI--WKSTRQFYACTKPETELPLTLVPK 2406987

Query:     427 RVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYP 467
               ..|..|||| | .|||||  |.||.|||  | | |.||| |
Sbjct: 2406986 KLGVYLDYEEGQVSFYNVETRTHIFTFTANFRETLFPLFAP 2406864

>Zv7_masked||Zv7_NA211 |chrNA|Len:47979

          Length = 47979

 Score =  143 bits (359), Expect = 2e-032
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 2/159 (1%)
 Frame = +2

Query:   307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
             | | |.| ||   . ||.|  .... |   . ||. | ||.|| ||| .||  |||| |.
Sbjct: 46289 APVILNPNTADVCVSLSDDLTTIRYSEEE-QLLPENPERFSFYECVLGSEGLVSGRHSWD 46465

Query:   367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPK 426
             ||||| . ||.|| ..|| ||    | || | | | |. |. | | |    || .| ||.
Sbjct: 46466 VEVGDCSEWALGVVKESVQRKEWFPPSPERGMWTVGLYGGE-YRARTPTSAPLKLKKKPQ 46642

Query:   427 RVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
             .. . || ||| ..| .  | | || . . ||||..| |
Sbjct: 46643 KIRVQLDCEAGRVTFSDAADNSIIYKYKNKFTEKVFPYF 46759

>Zv7_masked||Zv7_scaffold1025 |chr10|Len:919371|start:36202715|end:37122085

          Length = 919371

 Score =  141 bits (355), Expect = 5e-032
 Identities = 72/176 (40%), Positives = 104/176 (59%), Gaps = 1/176 (0%)
 Frame = +1

Query:    309 VTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVE 368
              .| . .||.| | |.     |.. .|    . | |.||     ..  .||| ||||||||
Sbjct: 703243 ITFNSKTANPWLSLTSSLTCVRY-QTFNSSVQDNPQRFNAALSLMGGQGFTKGRHYWEVE 703419

Query:    369 VGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV 428
              |   | | ||| |.||.||| .  .|  |.| . |  | .| | |.| | | ..    |.
Sbjct: 703420 VYSSTVWTVGVARESVTRKGVINTMPANGFWTLSLSYGVQYMAGTSPPTLLSLEEPLARI 703599

Query:    429 GIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPP 484
              |..|||. | .||||    .|.||| ||||| |.| |  |         || .  |
Sbjct: 703600 GVYLDYKRGLVSFYNAESMTHLYTFRDTFTETLFPYFNLGFLDKVHENEPLKVFMP 703767

>Zv7_masked||Zv7_scaffold1572 |chr16|Len:1454232|start:5719242|end:7173473

          Length = 1454232

 Score =  130 bits (325), Expect = 1e-028
 Identities = 77/184 (41%), Positives = 100/184 (54%), Gaps = 4/184 (2%)
 Frame = -1

Query:     306 IADVTLDPETAHPNLVLSEDRKSVKF---VETRLRDLPDTPRRFTFYPCVLATEGFTSGR 362
               |. .| ||||||| | || .| .| |    ||        |.|| .| ||. .|||| ||
Sbjct: 1112496 ISLLTFDPETAHPLLTLSPERTAVTFEEGKETGENAAERNPKRFHYYYCVMGSEGFTHGR 1112317

Query:     363 HYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIK 422
               |||||||  || | ||| |  | |    .     | | . | ||   | |    ||.   
Sbjct: 1112316 HYWEVEVKGKTAWRVGVARADVHRGEMDSSSTLNGLWTLSLRNGSITACTHPKPTPVLSY 1112137

Query:     423 VKPKRVGIFLDYEAGTLSFYNVTDRSHIYTF-TDTFTEKLWPLFYPGIRAGRKNAAPLTI 481
                 | |.|.||| .   .||||    . ...| | |    |.| . |      || |||.|
Sbjct: 1112136 TPPIRIGVFLDCDNEEVSFYNAVTMNPLFSFYTGTVLVPLYPFYNPCDTDEGKNCAPLSI 1111957

Query:     482 RPPT 485
                 |.
Sbjct: 1111956 FHPS 1111945

>Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end:27981893

          Length = 5306314

 Score =  127 bits (317), Expect = 1e-027
 Identities = 72/198 (36%), Positives = 109/198 (55%), Gaps = 8/198 (4%)
 Frame = +1

Query:     274 TMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVKFVE 333
               | ..    |...  .  |  |  .        .  | ||| ||.| |..|.| | .|  .
Sbjct: 1655839 TSDLIKAFIQVQMYYKQFKIQNLST.......VDVVVLDPNTANPELLVSDDGKYLKSKK 1656018

Query:     334 -TRLRDLPDTPR---RFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGE 389
                | | .     |   ||  . || | ||...||||||| |  |  | ||| ..|  | | 
Sbjct: 1656019 YTGLDNWEGFQRKKCRFDGWACVQAKEGYSTGRHYWEVGVKKKHEWRVGVVKESAPRNGY 1656198

Query:     390 LTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSH 449
               .    . ||| .||  |    | | | | |...  | ..|..|| | | .|||.   . |
Sbjct: 1656199 VNMNTKAGYWNLRLQLG-TVMALTEPVTKLNVQ-SPSKIGVYLDIEEGHVSFYDAEKQRH 1656372

Query:     450 IYTFTDTF--TEKLWPLF 465
               ||||   |  || ..|.|
Sbjct: 1656373 IYTFNTDFNETENIYPMF 1656426

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  122 bits (304), Expect = 4e-026
 Identities = 66/140 (47%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = +3

Query:   345 RFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLW 404
             ||  |  ||    |.| | |..|.|  || |..|| |.|| |||| |     |.| . | 
Sbjct: 93981 RFDRYVDVLGKGEFSSRRFYFDVQVKGKTDWSLGVVRESVDRKGETTQTASDGFWTL*LR 94160

Query:   405 NGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFT-DTFTEKLWP 463
             ||..  |   |   | .|||| |||.|.||| | . ||.|   ||||..|  |||.||.|
Sbjct: 94161 NGNQCKACADPPVSLSLKVKPHRVGVFVDYEEGLVCFYDVESSSHIYSYTGQTFTDKLYP 94340

Query:   464 LFYPGIRAGRKNAAPLTIRP 483
              | |      || ||  | |
Sbjct: 94341 YFSPEDN-DSKNLAPRIITP 94397

>Zv7_masked||Zv7_scaffold1365 |chr14|Len:2230408|start:9926351|end:12156758

          Length = 2230408

 Score =  121 bits (302), Expect = 7e-026
 Identities = 65/156 (41%), Positives = 93/156 (59%), Gaps = 5/156 (3%)
 Frame = -1

Query:     312 DPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCV--LATEGFTSGRHYWEVEV 369
               | .||||.| || ..  |         | || |   |  ||  |||||| || |||||.|
Sbjct: 1931920 DEDTAHPSLQLSRNKTQVIESNQMTSYLCDTKR---FLQCVNILATEGFQSGSHYWEVDV 1931750

Query:     370 GDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVG 429
                .   | .||  .||.|.  .   |. ||| .|| . ..|.| | |.| | .   | |.|
Sbjct: 1931749 SNNPKWDLGVALESVNRQVRVKLCPDNGYWTLRLRDANQYSAGTQPWTRLTVITSPCRIG 1931570

Query:     430 IFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
               |||| |   .||||  . . .|.|.     |..| |
Sbjct: 1931569 IFLDCEESKVSFYNADNMTLLYSFSSGPRGKVFPFF 1931462

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  117 bits (292), Expect = 1e-024
 Identities = 63/156 (40%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = -2

Query:    311 LDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVG 370
              ||| .||| | ||.|  |. .  |  . ||  | ||     ||    | |  | ||.|||
Sbjct: 407788 LDPNSAHPCLTLSDDLTSLHY-STPNQGLPSNPERFHISAEVLGCTAFNSSSHNWEIEVG 407612

Query:    371 DKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGI 430
              |   | .|.  .|| |  |.   || |.| .  .  ..| | ..| | | .. | .|| |
Sbjct: 407611 DNEDWILGLASESVKRDQEVPARPENGFWTI-CFRDEQYRAMSSPPTALQVEKKLQRVLI 407435

Query:    431 FLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
               |... | . | | . .  ||||   ||||| | ||
Sbjct: 407434 QLNWDKGEVVFLNPSYQEVIYTFKHAFTEKLLPYFY 407327

>Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:21986433

          Length = 288875

 Score =  117 bits (291), Expect = 1e-024
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 4/161 (2%)
 Frame = -2

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||||.|.||.|  ||.  | . |  |. | ||  .|||| .||| ||.| | 
Sbjct: 167275 APVILDPNTAHPHLILSDDLTSVRESEDK-RQFPNNPERFDRFPCVLGSEGFRSGKHSWV 167099

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLW-NGDKYAATTTPFTPLHIKVKP 425
              |||    .| .||   |  |||      .|  | |  . |  . .  .|  |   .  | 
Sbjct: 167098 VEVSYSFYWNLGVTTASNQRKGR--DFYDTNVWSVEYYENPPQDSLNSTVSTCFTVTQKL 166925

Query:    426 KRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
              . | . || . ||.|| .    .|..||| |||. ..| |.
Sbjct: 166924 ECVKVELDCDEGTVSFSDPATDTHLHTFTATFTDTVFPFFW 166802

>Zv7_masked||Zv7_scaffold1787 |chr18|Len:760096|start:5272124|end:6032219

          Length = 760096

 Score =  116 bits (290), Expect = 2e-024
 Identities = 63/169 (37%), Positives = 94/169 (55%), Gaps = 5/169 (2%)
 Frame = +2

Query:    300 KILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFT 359
              | .  |   || || | || |..|.|  .. . .   . ||  | |.  |  .| .||||
Sbjct: 168587 KSISFLTDPVTFDPNTGHPYLLVSDDLTTITYSDEHFQQLPANPERYDGYTSILGSEGFT 168766

Query:    360 SGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTP--FT 417
              .| | |.||||| | ||.||  .| . |  |      | | |   || ||    .|   |
Sbjct: 168767 AGSHTWDVEVGDNTAWAIGVITES-TYKNRLNHF-RMGMWYVGFCNG-KYGKGYSPEAIT 168937

Query:    418 PLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
               | .  | ||. . ||.. | ..| .      .. |  ||||...| ||
Sbjct: 168938 LLRVSQKIKRIRVKLDWDKGKVTFIDSDRNISLHVFKHTFTERVFPYFY 169084

>Zv7_masked||Zv7_scaffold280 |chr3|Len:181614|start:51916320|end:52097933

          Length = 181614

 Score =  112 bits (278), Expect = 4e-023
 Identities = 64/161 (39%), Positives = 95/161 (59%), Gaps = 7/161 (4%)
 Frame = +2

Query:    306 IADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYW 365
              .| | ||| ||. ..|||||  ||.  | . . ||| | ||  ||||| . || ||.| |
Sbjct: 140243 LAPVILDPNTANSHIVLSEDLTSVRESENK-QWLPDNPERFD-YPCVLGSVGFCSGKHRW 140416

Query:    366 EVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKP 425
              .||| .   |.|||   |  || ..     |  | |  |. | |    .     |..   
Sbjct: 140417 DVEVKESRCWSVGVTTASNQRKRDV--FFNTDVWSV--WH-DPYGLIKSSSNEFHVEQYL 140581

Query:    426 KRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
              . | . |||. ||. | .  . .|..||| |||. ..|  .
Sbjct: 140582 ECVRVELDYDRGTVCFSDPVNNTHLHTFTTTFTDTVFPFLW 140704

>Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:63261841

          Length = 347926

 Score =  110 bits (274), Expect = 1e-022
 Identities = 60/175 (34%), Positives = 94/175 (53%), Gaps = 2/175 (1%)
 Frame = -3

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              |. || |||||.| .| . |.|.    |         ||     .|     |||| .| |
Sbjct: 278174 DIILDTETAHPDLEVSTNGKAVR-DSGRNSGKSRGLNRFDQDGGILGKSSITSGRAFWMV 277998

Query:    368 EVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKR 427
              .|| |  | .|| |.  . ||...  |  ||| . |   . | |   |   | .   |..
Sbjct: 277997 DVGRKVGWQLGVMREGANMKGKISYKPSKGYWVIVLCGSNMYGAFEDPPIMLQLSSNPQK 277818

Query:    428 VGIFLDYEAGTLSFYNVTDRSHIYTFTD-TFTEKLWPLFYPGIRAGRKNAAPLTI 481
              .|...| ||  .|||..  ..||||. .  |   . | | | .     | .|| |
Sbjct: 277817 LGVYVDCEAALVSFYDMEAQTHIYTYRECRFNGAIRPYFNPHVNRDGNNGSPLVI 277653

>Zv7_masked||Zv7_scaffold2122 |chr21|Len:25789|start:44468724|end:44494512

          Length = 25789

 Score =  107 bits (266), Expect = 1e-021
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 7/160 (4%)
 Frame = -3

Query:  307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
            | | ||| ||. ..|||||  ||.  | . . ||| | ||  ||||| . || ||.| |.
Sbjct: 6764 APVILDPNTANSHIVLSEDLTSVRESENK-QWLPDNPERFD-YPCVLGSVGFCSGKHRWD 6591

Query:  367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPK 426
            ||| .   |.|||   |  || ..     |  | |  |. | |    .      ..   .
Sbjct: 6590 VEVKESRCWSVGVTTASNQRKRDV--FFNTDVWSV--WH-DPYGLIKSSSNEFPVEQYLE 6426

Query:  427 RVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
             | . |||. ||. | .  . .|..||| |||. ..|  .
Sbjct: 6425 CVRVELDYDRGTVCFSDPVNNTHLHTFTTTFTDAVFPFLW 6306

>Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|end:20116877

          Length = 1170280

 Score =  101 bits (249), Expect = 9e-020
 Identities = 63/170 (37%), Positives = 90/170 (52%), Gaps = 14/170 (8%)
 Frame = +1

Query:    301 ILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTS 360
              |.  | | ||||| |||||| .|.|  || .       .   |   .  |||| .||| |
Sbjct: 805030 II*NLSAVVTLDPSTAHPNLTVSDDLTSVTY-----NWVSADPEAMSSIPCVLGSEGFNS 805194

Query:    361 GRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYA----ATTTPF 416
              | |.|.||||| . |.||.      ||       .| .| |   ||   .     | . |
Sbjct: 805195 GTHWWDVEVGDNSCWSVGIMTAPKQRK--KYNFLDTEFWCVEYVNGGFLSPISKKTCSCF 805368

Query:    417 TPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFY 466
              |   || | . | . ||.| | ..| .    . . .||  | . |.|  |
Sbjct: 805369 T---IKTKLQMVRVQLDWEQGKVTFSDS...TPLCSFTSRFKKTLFPFLY 805509

>Zv7_masked||Zv7_scaffold221 |chr3|Len:298820|start:1455821|end:1754640

          Length = 298820

 Score =  100 bits (247), Expect = 2e-019
 Identities = 55/161 (34%), Positives = 83/161 (51%), Gaps = 10/161 (6%)
 Frame = -1

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||||.|..| |  ||..  .. | |||   ||  .|||||.||  ||   | 
Sbjct: 155279 APVVLDPNTAHPDLLVSADLSSVRWSWSK-RALPDNAERFDHHPCVLASEGVRSGTLSWA 155103

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWN--GDKYAATTTPFTPLHIKVK 424
              |||   . | .||  .   |||         ..   .|.   |.|. .  |   . .| .
Sbjct: 155102 VEVRQSSDWTLGVTTELNQRKG-------WDFFSADVWSVCYDEYSVSERPVFGVRVKQR 154944

Query:    425 PKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLF 465
               .|| . |||. ||.|| .  .                | |
Sbjct: 154943 LERVRVDLDYDGGTISFSDAVN................PFF 154821

>Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:21986433

          Length = 288875

 Score =  96 bits (238), Expect = 2e-018
 Identities = 46/126 (36%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query:     26 EASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCRKTSRYRSLRPNRQLG 85
              . ||||| |  |.||.. | |.||. |. ..|   .    | |||. |       |  | 
Sbjct: 139137 DISCSVCCEIFKDPVVLSCSHSFCRECLQQFWR-TKGTQECVVCRRRSSRDDPPNNLVLR 138961

Query:     86 SMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDD 145
              .. |   | .  ||    |  |  | | | ||| ||.. |||.|  |  |  |   |. .
Sbjct: 138960 NLCESFHQEKKEKRSSGSEETCSLHGEKLKLFCLEDKQPVCLVCVTSQQHDNHKFRPIGE 138781

Query:    146 ATQEYK 151
                  ||
Sbjct: 138780 VVPAYK 138763

>Zv7_masked||Zv7_scaffold2612 |chrUn|Len:171859

          Length = 171859

 Score =  93 bits (229), Expect = 2e-017
 Identities = 55/157 (35%), Positives = 80/157 (50%), Gaps = 4/157 (2%)
 Frame = +2

Query:    312 DPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGD 371
              |  |||  . |||.      |     . |. | ||.    || |.||. ||||||...  
Sbjct: 128471 DVRTAHKRISLSENNTKAT-VSDDPANYPEIPHRFSVCSQVLCTKGFSQGRHYWEIKMSS 128647

Query:    372 KTHWAVGVCRDSVSRKGELTPLPETG-YWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGI 430
                   .|.    . |||  . |      | |  |   | .|    |  .     | ||||
Sbjct: 128648 NNFCGLGLAYGKIDRKGPSSRLGRNAESWCVE-WFNVKLSAWHNSFETVLENPNPSRVGI 128824

Query:    431 FLDYEAGTLSFYNVTDRSH-IYTFTDTFTEKLWPLFY 466
               || . |. .|||| ||..  .||   ||| ..| |.
Sbjct: 128825 LLDCDQGSATFYNVQDRAYPFHTFVFPFTEAVYPAFW 128935

>Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:52508709

          Length = 410676

 Score =  93 bits (229), Expect = 2e-017
 Identities = 49/96 (51%), Positives = 59/96 (61%), Gaps = 3/96 (3%)
 Frame = +3

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||.| ||||.|  ||..    |  .|| | || || ||| .||||||.| | 
Sbjct: 140958 APVILDPNTANPRLVLSDDLTSVRYSRNNL-PVPDNPERFDFYSCVLGSEGFTSGKHCWV 141134

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVR 402
              ||| .   | .||   |  ||| .     || | ||
Sbjct: 141135 VEVKESPCWILGVSTASNQRKGNV--FFSTGVWSVR 141236

>Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end:44158972

          Length = 1894711

 Score =  93 bits (229), Expect = 2e-017
 Identities = 55/157 (35%), Positives = 80/157 (50%), Gaps = 4/157 (2%)
 Frame = -2

Query:    312 DPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGD 371
              |  |||  . |||.      |     . |. | ||.    || |.||. ||||||...  
Sbjct: 286638 DVRTAHKRISLSENNTKAT-VSDDPANYPEIPHRFSVCSQVLCTKGFSQGRHYWEIKMSS 286462

Query:    372 KTHWAVGVCRDSVSRKGELTPLPETG-YWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGI 430
                   .|.    . |||  . |      | |  |   | .|    |  .     | ||||
Sbjct: 286461 NNFCGLGLAYGKIDRKGPSSRLGRNAESWCVE-WFNVKLSAWHNSFETVLENPNPSRVGI 286285

Query:    431 FLDYEAGTLSFYNVTDRSH-IYTFTDTFTEKLWPLFY 466
               || . |. .|||| ||..  .||   ||| ..| |.
Sbjct: 286284 LLDCDQGSATFYNVQDRAYPFHTFVFPFTEAVYPAFW 286174

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  88 bits (217), Expect = 5e-016
 Identities = 44/129 (34%), Positives = 67/129 (51%), Gaps = 3/129 (2%)
 Frame = -2

Query:     23 LQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCRKTSRYRSLRPNR 82
              | .   | |||   |.|| . | |  |. | .|. |  .    || ||.      |.  |
Sbjct: 358820 LSLYLMCPVCLSDFKDPVSLPCEHVLCRQCASRYLESSKGPHKCPECRQNFTRTDLKGIR 358641

Query:     83 QLGSMVEIAKQLQAVKRKIR---DESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHT 139
               | ..|.  .. .  |. |.   .| || .| | | |||  ||  |||||     |  |.
Sbjct: 358640 VLRNVVDAIQEQRKKKQLIQPNAEEMLCSEHKEPLKLFCVNDQRLVCLICKEGMKHSGHS 358461

Query:    140 VVPLDDATQ 148
                |. .| .
Sbjct: 358460 FKPVKEAKE 358434

>Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:52508709

          Length = 410676

 Score =  88 bits (216), Expect = 6e-016
 Identities = 45/96 (46%), Positives = 62/96 (64%), Gaps = 3/96 (3%)
 Frame = +2

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||.| ||||.|  .|.|   . . .|| | || .| ||| .||||||.| |.
Sbjct: 266051 APVILDPNTANPRLVLSDDLTTVRFT-GKDQPVPDNPERFDYYECVLGSEGFTSGKHCWD 266227

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVR 402
              ||| .   |..||   |  |.| .     || | |.
Sbjct: 266228 VEVKESRCWSLGVTTASNQRRGWV--FFRTGVWGVQ 266329

>Zv7_masked||Zv7_scaffold2286 |chr23|Len:202071|start:41683726|end:41885796

          Length = 202071

 Score =  87 bits (215), Expect = 8e-016
 Identities = 62/183 (33%), Positives = 90/183 (49%), Gaps = 13/183 (7%)
 Frame = -2

Query:    308 DVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEV 367
              .| ||| .||| |..| .  || . .|  ... . | ||     |.. .|||  | ||||
Sbjct: 162791 EVILDPNSAHPKLIISPEGDSVTYTDT-WQEVSENPARFDTTLNVISRQGFTEVRSYWEV 162615

Query:    368 EVGDKTHWAVGVCRDSVSRKGE-----LTPLPETGYWRVRLWNGDKYAATTTPFTPLHIK 422
              ||  ||.| .|.    . |||      |   | .  | .  .| | | |       |   
Sbjct: 162614 EVTGKTYWELGLTYPDIPRKGREEDCWLGRGPSS--WCIEYFN-DIYTAWHNGVPHLLTD 162444

Query:    423 VKP---KRVGIFLDYEAGTLSFYNVTDRSHIYTF-TDTFTEKLWPLFYPGIRAGRKNAAP 478
              |     ||.|||   | | . |      . .|.|   |||. |.    ||      |  |
Sbjct: 162443 VGGRCFKRIGIFSSTEGGLVCFLGADTMTPLYSFCAGTFTDLLFQALCPGHDNQGTNGKP 162264

Query:    479 LTI 481
              | |
Sbjct: 162263 LLI 162255

>Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|end:5561318

          Length = 1049797

 Score =  87 bits (214), Expect = 1e-015
 Identities = 45/96 (46%), Positives = 59/96 (61%), Gaps = 3/96 (3%)
 Frame = +3

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||||.|.||.|  |..   |   |||| | ||  . ||| .||| || | |.
Sbjct: 101226 APVILDPNTAHPDLLLSDDLTSLR-CSTESGDLPDNPERFDEHSCVLGSEGFNSGTHCWD 101402

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVR 402
              ||| . . | .||   |  |||      ..| | |.
Sbjct: 101403 VEVKESSSWGLGVTTASNQRKG--CDFFDSGVWSVQ 101504

>Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|end:5561318

          Length = 1049797

 Score =  87 bits (214), Expect = 1e-015
 Identities = 45/96 (46%), Positives = 59/96 (61%), Gaps = 3/96 (3%)
 Frame = -1

Query:    307 ADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWE 366
              | | ||| ||||.|.||.|  |..   |   |||| | ||  . ||| .||| || | |.
Sbjct: 355945 APVILDPNTAHPDLLLSDDLTSLR-CSTESGDLPDNPERFDEHSCVLGSEGFNSGTHCWD 355769

Query:    367 VEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVR 402
              ||| . . | .||   |  |||      ..| | |.
Sbjct: 355768 VEVKESSSWGLGVTTASNQRKG--CDFFDSGVWSVQ 355667

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0