BLASTP 7.6.0


Query=uc003rax |6_cox_hap1|AY787587|NA|NA|HLA-A|NA|NA|Homo sapiens mRNA for HLA
       class I histocompatibility antigen, A-1 alpha chain precursor variant
       protein
        (222 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|en...     62   1e-008
Zv7_masked||Zv7_scaffold2215 |chr22|Len:371666|start:37461184|en...     59   9e-008
Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|en...     56   7e-007
Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:...     54   2e-006
Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:...     54   2e-006
Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:...     54   2e-006
Zv7_masked||Zv7_scaffold372 |chr4|Len:172962|start:36468659|end:...     54   3e-006
Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:...     54   3e-006
Zv7_masked||Zv7_scaffold307 |chr3|Len:28637|start:61015361|end:6...     54   4e-006
Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:...     53   6e-006
Zv7_masked||Zv7_scaffold885 |chr8|Len:63479|start:56137207|end:5...     53   6e-006
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         52   1e-005
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         51   2e-005
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     49   1e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     49   1e-004
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         49   1e-004
Zv7_masked||Zv7_scaffold1389 |chr14|Len:23964|start:38829338|end...     48   2e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     48   2e-004
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         47   3e-004
Zv7_masked||Zv7_scaffold242 |chr3|Len:1283330|start:21986534|end...     47   3e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     47   5e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     47   5e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     47   5e-004
Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|en...     47   5e-004
Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|en...     47   5e-004
Zv7_masked||Zv7_scaffold1389 |chr14|Len:23964|start:38829338|end...     46   6e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     46   6e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     46   6e-004
Zv7_masked||Zv7_scaffold576 |chr6|Len:304303|start:8241381|end:8...     46   8e-004
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     45   0.001
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     45   0.001
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         45   0.001
Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:...     45   0.001
Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:...     45   0.002
Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:...     44   0.002
Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|en...     44   0.004
Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771         44   0.004
Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|en...     43   0.005

>Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|end:8405673

          Length = 3940805

 Score =  62 bits (149), Expect = 1e-008
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = +2

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGE--EQRYTCH 163
              | | ||||. | ..||..|.|  .| || |  |  |||||| . . |   |    ...| 
Sbjct: 266447 CHATGFYPSGIKISWQKNGQDHDEDVELGELLPNADGTFQKRSTLNVKPEEWKNSKFSCV 266626

Query:    164 VQHEG 168
              |.|.|
Sbjct: 266627 VEHQG 266641

>Zv7_masked||Zv7_scaffold2215 |chr22|Len:371666|start:37461184|end:37832849

          Length = 371666

 Score =  59 bits (141), Expect = 9e-008
 Identities = 25/66 (37%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = -3

Query:    104 LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR--YT 161
              . |.| ||||. . .|| ..|.|  .. || | .|  |||||. ... |   . ..  ||
Sbjct: 264174 VECFATGFYPSGVIITWLKNGQDHGENVELRELKPNEDGTFQRSSSLHVSQEDWKKSLYT 263995

Query:    162 CHVQHE 167
              | |.|.
Sbjct: 263994 CVVEHQ 263977

>Zv7_masked||Zv7_scaffold1881 |chr19|Len:3940805|start:4464869|end:8405673

          Length = 3940805

 Score =  56 bits (133), Expect = 7e-007
 Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +1

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGE--EQRYTCH 163
              |   ||||. . ..|||.|.|  .| || |  |  |||.|. . . |   |  . ...| 
Sbjct: 316924 CHVTGFYPSGLKISWQRNGQDHDEDVELGELIPNEDGTYQRTSTLNVKPEEWKKDKFSCV 317103

Query:    164 VQHE 167
              |.|.
Sbjct: 317104 VEHQ 317115

>Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:45081073

          Length = 4593234

 Score =  54 bits (129), Expect = 2e-006
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -1

Query:       7 GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-RRVYLEG 65
               | | || ||  . .|||..... ..    | |    |  |||||. |    |  . ||| 
Sbjct: 3596112 GNDVRFSRGIDEYSYDGRNFLSFDDAESQWVAPVEEALPTKRKWDNVPILNQYTKGYLEK 3595933

Query:      66 RCVDGLRRYLENGKETLQ 83
                ||| | .. | | . |.
Sbjct: 3595932 ECVDWLNKFREYGDKELR 3595879

>Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:45081073

          Length = 4593234

 Score =  54 bits (129), Expect = 2e-006
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query:       9 DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-RRVYLEGRC 67
               | || .|  . .|||..... ..    | |   ||  |||||. |    |  . |||  |
Sbjct: 3568719 DVRFSKGIDEYSYDGENFLSFDDADSQWVAPVDAALPTKRKWDNVPILNQYTKGYLEKEC 3568540

Query:      68 VDGLRRYLENGKETLQ 83
               || | .. | | | |.
Sbjct: 3568539 VDWLNKFREYGNEELR 3568492

>Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:45081073

          Length = 4593234

 Score =  54 bits (129), Expect = 2e-006
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -3

Query:       7 GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-RRVYLEG 65
               | | || .|  . .|||....| ..    | |    |  |||||. |    |  . ||| 
Sbjct: 3557368 GNDVRFSKGIDEYSYDGRNFLAFDDADSQWVAPVEEALPTKRKWDNVPILNQYTKGYLEK 3557189

Query:      66 RCVDGLRRYLENGKETLQ 83
                ||| | .. | | . |.
Sbjct: 3557188 ECVDWLNKFREYGDQELR 3557135

>Zv7_masked||Zv7_scaffold372 |chr4|Len:172962|start:36468659|end:36641620

          Length = 172962

 Score =  54 bits (128), Expect = 3e-006
 Identities = 32/88 (36%), Positives = 43/88 (48%), Gaps = 6/88 (6%)
 Frame = -2

Query:    86 DPPKTHMTHHPISDHEA----TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGD 141
             |||.| .  .|  | |     || | | ||||  | . |  .  . |.   | . ||  |
Sbjct: 67481 DPPQTSI--YPKDDVELGVQNTLVCHATGFYPPSIRILWTMNNVNVTEGISLSQYRPRVD 67308

Query:   142 GTFQKWAAVVVPSGEEQRYTCHVQHEGL 169
             |||  ..       |   |.| | || |
Sbjct: 67307 GTFNIFSTFRFTPAEGDIYSCRVIHEAL 67224

>Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:45081073

          Length = 4593234

 Score =  54 bits (128), Expect = 3e-006
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = -3

Query:       7 GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-RRVYLEG 65
               | . || .|  . .|||..... ..    | |   ||  |||||. |    |  . ||| 
Sbjct: 3581509 GNEHRFSKGIDEYSYDGRNFLSFDDAESQWVAPVDAALPTKRKWDNVPILNQYTKGYLEK 3581330

Query:      66 RCVDGLRRYLENGKETLQ 83
                ||| | .. | | . |.
Sbjct: 3581329 ECVDWLNKFREYGDQELR 3581276

>Zv7_masked||Zv7_scaffold307 |chr3|Len:28637|start:61015361|end:61043997

          Length = 28637

 Score =  54 bits (127), Expect = 4e-006
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 4/84 (4%)
 Frame = -2

Query:     4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
             |.|   | . .| .|  .  |||....| .|    | |    |  |||||..|    |  
Sbjct: 19768 CEVEIKGSEVKFSKGIDEYGYDGENFLAFDEAESQWVAPVEEALPTKRKWDSVPILNQYT 19589

Query:    60 RVYLEGRCVDGLRRYLENGKETLQ 83
             . |||  ||| | .. |   | |.
Sbjct: 19588 KGYLEKECVDWLNKFREYANEELR 19517

>Zv7_masked||Zv7_scaffold53 |chr1|Len:4593234|start:40487840|end:45081073

          Length = 4593234

 Score =  53 bits (125), Expect = 6e-006
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = -3

Query:      87 PPKTHMTHHPISDHEATLR--CWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGT 143
               ||  |.    | . .| |.  | | |||| .. || ..       .| |    ||  |||
Sbjct: 3566785 PPDVHVFARSIINGKAKLKLTCLATGFYPKDVYLTIRKYRMALLDKDLESSGVRPNHDGT 3566606

Query:     144 FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW 177
               ||   .  .   |.  | |.|.|  |  |.  .|
Sbjct: 3566605 FQLRMSTYIYEDEKAEYDCYVKHRTLGAPIIKKW 3566504

>Zv7_masked||Zv7_scaffold885 |chr8|Len:63479|start:56137207|end:56200685

          Length = 63479

 Score =  53 bits (125), Expect = 6e-006
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 7/97 (7%)
 Frame = -2

Query:   86 DPPKTHMTHHPISDHEA----TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGD 141
            | |.| .  .|  | |     || |   ||||  ....| ..  . ..|  | . ||  |
Sbjct: 9532 DAPQTSI--YPKDDVELGVQNTLVCHVTGFYPPSVSVSWTKNNINVSEDITLSQYRPRID 9359

Query:  142 GTFQKWAAVVVPSGEEQRYTCHVQHEGL-PKPLTLRW 177
            |||  .. .     |   |.| |.|  .  .| |  |
Sbjct: 9358 GTFNIFSTLKFTPAEGDIYSCMVKHRAIKDQPQTKTW 9248

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  52 bits (122), Expect = 1e-005
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 4/85 (4%)
 Frame = -3

Query:      4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
              |.|   | . .| .|  .  |||....| .|    | |    |  |||||  .    |  
Sbjct: 365795 CEVEIQGSEVKFSKGIDEYGYDGENFLAFDEAESQWVAPVEEALPTKRKWNNIPILNQYT 365616

Query:     60 RVYLEGRCVDGLRRYLENGKETLQR 84
              . |||  ||| | .. |   | |..
Sbjct: 365615 KGYLEKECVDWLNKFREYADEELRK 365541

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  51 bits (121), Expect = 2e-005
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 4/84 (4%)
 Frame = -2

Query:      4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
              |.|   | . .| .|  .  |||..... .|    | |    |  |||||. |    |  
Sbjct: 361824 CEVEIQGSEVKFSKGIDEYGYDGENFLSFDEAESQWVAPVKEALPTKRKWDNVPILNQYT 361645

Query:     60 RVYLEGRCVDGLRRYLENGKETLQ 83
              . |||  ||| | .. |   | |.
Sbjct: 361644 KGYLEKECVDWLNKFREYADEELR 361573

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  49 bits (114), Expect = 1e-004
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 6/89 (6%)
 Frame = -2

Query:     85 TDPPKTHMTHHPISDH-EATLRCWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGD 141
              |  |.  . .   ||  .  . | | ||||  | ||  |||.    | |.   .  | ||
Sbjct: 438800 TVKPEVRLFYEANSDSGDFRVSCLATGFYPRHINLTLLRDGQ-PVSDYEVTGGDLLPNGD 438624

Query:    142 GTFQKWAAVVVPSGEEQ--RYTCHVQHEG 168
              ||.|   .. . . | |  .||| ..| |
Sbjct: 438623 GTYQMRKSLEIRAEERQKHKYTCSIKHLG 438537

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  49 bits (114), Expect = 1e-004
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 5/72 (6%)
 Frame = -3

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQKWAAVVVPSGEEQ--RYT 161
              | | ||||  | ||  |||.    | |.   .  | ||||.|   .. . . | |  .||
Sbjct: 378568 CLATGFYPRHINLTLLRDGQ-PVSDHEVTGGDLLPNGDGTYQMRKSLEIRAEERQKHKYT 378392

Query:    162 CHVQHEGLPKPL 173
              |  .| ||   |
Sbjct: 378391 CSAKHLGLDNKL 378356

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  49 bits (114), Expect = 1e-004
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 5/73 (6%)
 Frame = -2

Query:    104 LRCWALGFYPAEITLTWQRD--GEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYT 161
              | | | |||| .. |  .|.   ||.|. | .   ||  | |||   .| .   .   | 
Sbjct: 375783 LTCLATGFYPNDVMLNIRRNCLPEDETESTGV---RPNHDQTFQLRKSVEIKEDQIDEYD 375613

Query:    162 CHVQHEGLPKPLT 174
              ||. |  |  |.|
Sbjct: 375612 CHLTHRTLKNPVT 375574

>Zv7_masked||Zv7_scaffold1389 |chr14|Len:23964|start:38829338|end:38853301

          Length = 23964

 Score =  48 bits (113), Expect = 2e-004
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)
 Frame = +2

Query:    4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
            |.|   | . .| .|  .  |||.. .. .|    | |    |  |||||. |    |  
Sbjct: 3941 CEVEIQGSEVKFSKGVSEYGYDGENLLSFDETESQWVAPVKEALPTKRKWDNVPILNQYT 4120

Query:   60 RVYLEGRCVDGLRRYLE 76
            . |||  ||| | .. |
Sbjct: 4121 KGYLEKECVDWLNKFRE 4171

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  48 bits (112), Expect = 2e-004
 Identities = 29/113 (25%), Positives = 44/113 (38%), Gaps = 5/113 (4%)
 Frame = -1

Query:     60 RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT 119
              |..|                        |.  .           . | | ||||  | ||
Sbjct: 426753 RIFLNCT...................VKPQVRLIQKASDSGGFVVSCLATGFYPRHINLT 426574

Query:    120 WQRDGEDQTQDTELV--ETRPAGDGTFQKWAAVVVPSGEEQR--YTCHVQHEG 168
                |||.    | |    .  | ||||.|   .. . . | ..  |||  .| |
Sbjct: 426573 LLRDGQ-PVSDHEFTGGDLLPNGDGTYQMRKSLEISAEEREKHNYTCSAKHMG 426418

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  47 bits (111), Expect = 3e-004
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 4/85 (4%)
 Frame = -1

Query:      4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
              |.|   | . .| .|  .  |||.. .  ..    | |    |  |||||. .    |  
Sbjct: 376180 CEVEIQGSEVKFSKGVSEYGYDGENLLYFDDAESRWVAPVEEALPTKRKWDNIPILNQYT 376001

Query:     60 RVYLEGRCVDGLRRYLENGKETLQR 84
              . |||  ||| | .. |   | |..
Sbjct: 376000 KGYLEKECVDWLNKFREYADEELRK 375926

>Zv7_masked||Zv7_scaffold242 |chr3|Len:1283330|start:21986534|end:23269863

          Length = 1283330

 Score =  47 bits (111), Expect = 3e-004
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = +2

Query:    104 LRCWALGFYPAEITLTWQRDGEDQTQDTEL-VETRPAGDGTFQKWAAVVVPSGEEQR--- 159
              . | | ||||  | ||  .||.   ..  .  |  |  |||.|   .| . | ||||   
Sbjct: 817064 MTCLATGFYPRHINLTLLQDGQPVNEERVMGGELLPNADGTYQMRKSVEL-SAEEQRERR 817240

Query:    160 -YTCHVQHEGLPKPLTLRWELSSQ 182
               ||| | |  |   | .   .| |
Sbjct: 817241 TYTCTVNHLSLDNKLDISIGISYQ 817312

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  47 bits (109), Expect = 5e-004
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = -1

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQKWAAVVVPSGEEQ--RYT 161
              | | ||||  | ||  |||.    | |.   .  | ||||||   .. . . | |  .||
Sbjct: 320736 CLATGFYPRHINLTLLRDGQ-PVSDHEVTGGDLLPNGDGTFQMRKSLEIRAEERQKNKYT 320560

Query:    162 CHVQHEGLPKPL 173
              |   |  |   |
Sbjct: 320559 CSATHLSLDNKL 320524

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  47 bits (109), Expect = 5e-004
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = -1

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQ--KWAAVVVPSGEEQRYT 161
              | | ||||  | ||  |||.    | ||   .  | ||||.|  |   .     |. .|.
Sbjct: 354738 CLATGFYPRHINLTLLRDGQ-PVSDHELTGGDLLPNGDGTYQMRKSLEIRAEEREKHKYS 354562

Query:    162 CHVQHEGLPKPL 173
              | |.|  |   |
Sbjct: 354561 CSVKHLSLDNKL 354526

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  47 bits (109), Expect = 5e-004
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 4/93 (4%)
 Frame = -3

Query:     85 TDPPKTHMTHHPISDHEA-TLRCWALGFYPAEITLTWQRDGEDQTQ-DTELVETRPAGDG 142
              |  ||  .     ||     . | | ||||  | ||  |||.  .. .    .  | |||
Sbjct: 371668 TVKPKVRLFQKANSDSGGFRVNCLATGFYPRHINLTLLRDGQPVSENEVTGGDLLPNGDG 371489

Query:    143 TFQKWAAVVVPSGEEQ--RYTCHVQHEGLPKPL 173
              |.|   .. . . | |  .|||  .|  |   |
Sbjct: 371488 TYQMRKSLEIRAEERQKHKYTCSAKHLSLDNKL 371390

>Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|end:31612629

          Length = 171026

 Score =  47 bits (109), Expect = 5e-004
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 5/80 (6%)
 Frame = +1

Query:    98 SDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQKWAAVVVPSG 155
             ||    . | | ||||  | ||  |||.    | |.   .  | ||||.|   .. . . 
Sbjct: 74842 SDSGFCVSCLATGFYPRHINLTLLRDGQ-PVSDHEVTGGDLLPNGDGTYQMRKSLEISAE 75018

Query:   156 EEQ--RYTCHVQHEGLPKPL 173
             | |  .|.|  .|  |   |
Sbjct: 75019 ERQKHKYSCSAKHLSLDNKL 75078

>Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|end:31612629

          Length = 171026

 Score =  47 bits (109), Expect = 5e-004
 Identities = 27/67 (40%), Positives = 36/67 (53%), Gaps = 5/67 (7%)
 Frame = +1

Query:   106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQ--KWAAVVVPSGEEQRYT 161
             | | ||||  | ||  |||.    | |.   .  | ||||.|  |   .     |. .|.
Sbjct: 67042 CLATGFYPRHINLTLLRDGQ-SVSDHEVTGGDLLPNGDGTYQMRKSLEIKAEEREKHKYS 67218

Query:   162 CHVQHEG 168
             | |.| |
Sbjct: 67219 CSVKHMG 67239

>Zv7_masked||Zv7_scaffold1389 |chr14|Len:23964|start:38829338|end:38853301

          Length = 23964

 Score =  46 bits (108), Expect = 6e-004
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +3

Query:  104 LRCWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC 162
            | | | ||||... |  .|.      |.|     ||  | |||   .| .   .   | |
Sbjct: 4338 LTCLATGFYPSDVMLNIRRNRVYLPEQETISTGVRPNHDQTFQLSKSVEIKEDQIDEYDC 4517

Query:  163 HVQHEGLPKPLTLRW 177
             | |    .|. ..|
Sbjct: 4518 SVSHRTFKQPIIIKW 4562

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  46 bits (108), Expect = 6e-004
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = -1

Query:    106 CWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQ--RYTC 162
              | | ||||  | ||  |||.     |    .  | ||||.|   .. . . | |  .|.|
Sbjct: 339858 CLATGFYPRHINLTLLRDGQPVSDHDVTGGDLLPNGDGTYQMRKSLEIRAEERQKHKYSC 339679

Query:    163 HVQHEGLPKPL 173
               |.|  |   |
Sbjct: 339678 SVKHLSLDNKL 339646

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  46 bits (108), Expect = 6e-004
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 5/72 (6%)
 Frame = -2

Query:    106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQ--KWAAVVVPSGEEQRYT 161
              | | ||||  | ||  |||.    | |.   .  | ||||.|  |   .     |. .||
Sbjct: 361295 CLATGFYPRHINLTLLRDGQ-PVSDNEVTGGDLLPNGDGTYQMRKSLEIRAEEREKHKYT 361119

Query:    162 CHVQHEGLPKPL 173
              |  .|  |   |
Sbjct: 361118 CSAKHLSLDNKL 361083

>Zv7_masked||Zv7_scaffold576 |chr6|Len:304303|start:8241381|end:8545683

          Length = 304303

 Score =  46 bits (107), Expect = 8e-004
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = -1

Query:   104 LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQ--KWAAVVVPSGEEQRYT 161
             | |.| |||| .| . .  .|.  |   |  .     | ||.  |.  .   .|.|  ||
Sbjct: 44626 LYCYATGFYPGDIDIRFFLNGQKSTAKLETSDLMYGEDWTFRVFKYMKITPQTGDE--YT 44453

Query:   162 CHVQHEGLPKPLTLRW 177
             | |.|  . .|    |
Sbjct: 44452 CEVRHSSMSEPKITVW 44405

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  45 bits (106), Expect = 0.001
 Identities = 27/71 (38%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = -3

Query:    106 CWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGTFQ--KWAAVVVPSGEEQRYTC 162
              | | ||||  | ||  |||.     |    .  | ||||.|  |   .     |. .|||
Sbjct: 328495 CLATGFYPRHINLTLLRDGQPVSDHDVTGGDLLPNGDGTYQMRKSLQIRAEEREKHKYTC 328316

Query:    163 HVQHEGLPKPL 173
                .|  |   |
Sbjct: 328315 SAKHLSLDNKL 328283

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  45 bits (106), Expect = 0.001
 Identities = 31/87 (35%), Positives = 40/87 (45%), Gaps = 6/87 (6%)
 Frame = +3

Query:     85 TDPPKTHMTHHPISDHEA-TLRCWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGD 141
              |  ||  . |    |     . | | ||||  | ||  |||.    | |    .  | ||
Sbjct: 397500 TVEPKVRIFHKANLDFGGFRVSCLATGFYPRHINLTLLRDGQ-PVSDHEFTGGDLLPNGD 397676

Query:    142 GTFQ--KWAAVVVPSGEEQRYTCHVQH 166
              ||.|  |   .     |. .|||  .|
Sbjct: 397677 GTYQMRKSLEIRAEDSEKHKYTCSFKH 397757

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  45 bits (106), Expect = 0.001
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 4/85 (4%)
 Frame = -3

Query:      4 CDV---GPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ-R 59
              |.|   | .  | .   .  |||.|..  ..    | |    |  |||||. .    |  
Sbjct: 402266 CEVEKQGNEHSFNKSIDEYGYDGEDFLYYDDAESRWVAPVEEALPTKRKWDNLPILNQYT 402087

Query:     60 RVYLEGRCVDGLRRYLENGKETLQR 84
              . |||  ||| | .. |   | |..
Sbjct: 402086 KDYLEKECVDWLNKFREYADEELRK 402012

>Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:40469683

          Length = 692935

 Score =  45 bits (105), Expect = 0.001
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 11/96 (11%)
 Frame = -3

Query:     88 PKTHMTHHPISDHEAT-LRCWALGFYPAEITLTWQRDGE----DQTQDTELVETRPAGDG 142
              |.  .    .|| .   . | | ||||  | ||  || |    ||    |..  |   ||
Sbjct: 641798 PRVRLMKKKLSDCQGL*ISCLATGFYPRHINLTLFRDAEPVDDDQITGGEILPNR---DG 641628

Query:    143 TFQKWAAVVVPSGEEQR---YTCHVQHEGLPKPLTL 175
              |.|   ....   | |.   | | |.|  |   | .
Sbjct: 641627 TYQMRKSLIISEEELQKGHQYNCTVKHLNLDNKLDI 641520

>Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:40469683

          Length = 692935

 Score =  45 bits (104), Expect = 0.002
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 7/94 (7%)
 Frame = +2

Query:     88 PKTHMTHHPISDHEA-TLRCWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTF 144
              |.  .    . | .   . | | ||||  | ||  || |    | ...  |  | ||| .
Sbjct: 611375 PRVRLMKKKLPDSQGLQISCLATGFYPRHINLTLFRDAE-PVDDDQIIGGEILPNGDGMY 611551

Query:    145 QKWAAVVVPS---GEEQRYTCHVQHEGLPKPLTL 175
              |   ...|      |   ||| ..|  |   | .
Sbjct: 611552 QMRKSLIVSKEELDEGHEYTCTMKHLNLDNKLDI 611653

>Zv7_masked||Zv7_scaffold815 |chr8|Len:692935|start:39776749|end:40469683

          Length = 692935

 Score =  44 bits (103), Expect = 0.002
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 11/96 (11%)
 Frame = -3

Query:     88 PKTHMTHHPISDHEA-TLRCWALGFYPAEITLTWQRDGE----DQTQDTELVETRPAGDG 142
              |.  .    .|| .   . | | ||||  | ||  || |    ||    |..   | |||
Sbjct: 629030 PRVRLMQKKLSDSQGLQISCLATGFYPRHINLTLFRDAELVDDDQITGGEIL---PNGDG 628860

Query:    143 TFQKWAAVVVPSGEEQ---RYTCHVQHEGLPKPLTL 175
              |.|   ...|   | |   .| |   .  |   . .
Sbjct: 628859 TYQMRKSLIVSEEELQKGHKYNCTANYLNLDNKMDI 628752

>Zv7_masked||Zv7_scaffold2110 |chr21|Len:484392|start:42429996|end:42914387

          Length = 484392

 Score =  44 bits (101), Expect = 0.004
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -1

Query:    106 CWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGTFQKWAAVVV--PSGEEQRYTC 162
              | | ||||  | ||  |||.          .  | ||||.|   .. .     |. .|||
Sbjct: 283944 CLATGFYPRHINLTLLRDGQPVSDHGVTGGDLLPNGDGTYQMRKSLEIRGEEREKHKYTC 283765

Query:    163 HVQHEGLPKPLTL 175
                 |  | | | .
Sbjct: 283764 SATHLSLDKKLDI 283726

>Zv7_masked||Zv7_scaffold216 |chr3|Len:484771|start:1|end:484771

          Length = 484771

 Score =  44 bits (101), Expect = 0.004
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = -1

Query:    104 LRCWALGFYPAEITLTWQRDGED-QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC 162
              | | | |||| .. |  .|       |.|     ||  | |||   .| .   .   | |
Sbjct: 401869 LTCLATGFYPNDVMLNIRRYRVYLPEQETISTGVRPNHDQTFQLSKSVEIKEDQIDNYDC 401690

Query:    163 HVQHEGLPKPLTLRW 177
               | |    .|. ..|
Sbjct: 401689 SVSHRTFKQPIIIKW 401645

>Zv7_masked||Zv7_scaffold2470 |chr25|Len:171026|start:31441604|end:31612629

          Length = 171026

 Score =  43 bits (100), Expect = 0.005
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 5/65 (7%)
 Frame = -2

Query:   106 CWALGFYPAEITLTWQRDGEDQTQDTELV--ETRPAGDGTFQ--KWAAVVVPSGEEQRYT 161
             | | ||||  | ||  |||.    | |.   .  | ||||.|  |   .     |. .|.
Sbjct: 54079 CLATGFYPRHINLTLLRDGQ-PVSDHEVTGGDLLPNGDGTYQMRKSLEISAEEREKHKYS 53903

Query:   162 CHVQH 166
             |  .|
Sbjct: 53902 CSAKH 53888

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0