BLASTP 7.6.0


Query=uc003qyn
       |6_cox_hap1|NM_001005216|Q6IF25|Q6IF25_HUMAN|OR2J3|NM_001005216|NP_00100
       5216|olfactory receptor, family 2, subfamily J,
        (311 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|en...    191   4e-047
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    186   9e-046
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    178   2e-043
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    151   2e-035
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    148   3e-034
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    143   7e-033
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    142   2e-032
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    141   4e-032
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    137   5e-031
Zv7_masked||Zv7_scaffold1549 |chr15|Len:61801|start:45659510|end...    137   6e-031
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    137   6e-031
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    136   8e-031
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    136   1e-030
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    136   1e-030
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    135   2e-030
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    133   7e-030
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    133   9e-030
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    132   1e-029
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    132   2e-029
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    131   3e-029
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    130   7e-029
Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|en...    128   2e-028
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    127   5e-028
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    127   6e-028
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    126   1e-027
Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|en...    126   1e-027
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    125   2e-027
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    123   7e-027
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    122   2e-026
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    122   2e-026
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    122   2e-026
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    121   3e-026
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    121   3e-026
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    121   3e-026
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    121   3e-026
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    120   6e-026
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    119   1e-025
Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end...    119   1e-025
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    119   2e-025
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    117   5e-025
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    114   3e-024
Zv7_masked||Zv7_scaffold2129 |chr21|Len:70142|start:45129009|end...    114   6e-024
Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|e...    113   9e-024
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...    110   6e-023
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    108   2e-022
Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|en...    105   2e-021
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...    105   2e-021
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...     91   4e-017
Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|en...     80   7e-014
Zv7_masked||Zv7_scaffold2129 |chr21|Len:70142|start:45129009|end...     74   4e-012
Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|en...     57   6e-007
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...     54   7e-006
Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|en...     49   2e-004

>Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|end:32655019

          Length = 557194

 Score =  191 bits (483), Expect = 4e-047
 Identities = 110/270 (40%), Positives = 153/270 (56%), Gaps = 2/270 (0%)
 Frame = -2

Query:     38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
              |.  | ||  || |   |  | ||||||| |||| |. ||. .||..|      .|||| 
Sbjct: 366909 YVSVLSGNSMIIYLVRTDPKLDTPMYFFLHNLSFSDIVYTSVTIPKMLSVFLTGDKTISK 366730

Query:     98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
               || .|. ||| .|     ||  |..||| |.| || || .|  . | ||  |||  |  
Sbjct: 366729 TGCFMQIQFVLWMGLTGRGLLTAMAFDRYVAICNPLRYTTIMTRKLCVLLIFASWTYGAL 366550

Query:    158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                     .   .| ||   | | ||.  ..| |.||||  |    .  . | .|.  .||
Sbjct: 366549 IVLPPVIWATQLPYCGPNVVKHMFCDHSSVLTLACVDTTRNSFFALALALIGLLLTFLLI 366370

Query:    218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGK-F 276
              | ||  | .|. ||     | |   || .||. | . .  |  .|.         . .  
Sbjct: 366369 LISYVYIGKAMRRMSMAQKL-KAGATCVSHLIVVFISYCSAFFVYISYRVSKFDPEVRIM 366193

Query:    277 IALFYTVVTPSLNPLIYTLRNKVVRGAVKR 306
              ||| |.|.|| |||.||.|||| .. |.||
Sbjct: 366192 IALLYSVLTPLLNPIIYSLRNKELQDAMKR 366103

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  186 bits (471), Expect = 9e-046
 Identities = 97/302 (32%), Positives = 163/302 (53%), Gaps = 3/302 (0%)
 Frame = +1

Query:       8 NASSEGYFILVGFSN-WPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFL 66
               | |    |..|||    ||            || |||||     |  .   || |.|.|.
Sbjct: 1523977 NTSFAKDFVIVGFPGLQPHYYGLVSALLFFVYLFTLIGNAVFFTLFVITKSLHKPVYYFI 1524156

Query:      67 SNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRY 126
                ||   |. ..|...|...   |  . |||. || .|..||  ||.|  |.| ||. |||
Sbjct: 1524157 INLVASDVLFSTTTLPKIISRYWFQDGTISFLGCFVQMFFVHFLGSACSVVLAVMAIDRY 1524336

Query:     127 AAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPA 186
                |.| || |  .|  |   .| .. |.  |          . .| |    . | .|.  .
Sbjct: 1524337 TAICYPLQYHSIMTNRNVLILILSPWILSFLGPLALVIRAYPLPYCADNSIIHCYCDHVS 1524516

Query:     187 LLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGA 246
               .  |.| |  .  .  .| . . .|.|  .|. || .|  ||.|.  . |  | | ||  
Sbjct: 1524517 ITTLACTDRSLYSIPALIYAFLILLVPFAVIIFSYCSIFIAVMRISGSQGRMKTFSTCSP 1524696

Query:     247 HLMAVSLFFIPAMCIYLQPPSG--NSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                |. ..|.||| .  ||    |   | |    . . |.|. | .||.|| || . |.  .
Sbjct: 1524697 QLIIIALYFIPRVFNYLSSNIGLKFSTDLRIIMIMMYSVLPPLINPIIYCLRTEEVKKVL 1524876

Query:     305 KR 306
               ..
Sbjct: 1524877 RQ 1524882

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  178 bits (450), Expect = 2e-043
 Identities = 92/302 (30%), Positives = 160/302 (52%), Gaps = 3/302 (0%)
 Frame = +1

Query:       8 NASSEGYFILVGFSN-WPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFL 66
               | |    |..|||    ||            |. |||||     |  .   || |.|.|.
Sbjct: 1517176 NTSFVKDFVIVGFPGLQPHYYGLVSALLFFVYVFTLIGNAVFFTLFVITKSLHKPVYYFI 1517355

Query:      67 SNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRY 126
                ||   |. ..|... ...   |  . |||. || .|..||   |.   |.| ||. |||
Sbjct: 1517356 INLVVSDVLFSTATLTKIISRYWFQDGTISFLGCFVQMFFVHLFGSVCSVVLAVMAIDRY 1517535

Query:     127 AAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPA 186
                |.| || |  .|  |   .| .. |.  |          . .| |    . | .|.  .
Sbjct: 1517536 TAICYPLQYHSIMTNRNVLILILSPWILSFWGPLALVIRAYPLPYCADNSIIHCYCDHVS 1517715

Query:     187 LLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGA 246
               .  |.| |  .  .  .| . . .|.|  .|. || .|  ||.|.  . |  | | ||  
Sbjct: 1517716 ITTLACTDRSLYSIPALIYAFLILLVPFAVIIFSYCSIFIAVMRISGSQGRMKTFSTCSP 1517895

Query:     247 HLMAVSLFFIPAMCIYLQPPSG--NSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                |. ..|.||| .  .|    |   | |    . . |.|. | .||.|| || . |.  .
Sbjct: 1517896 QLIIIALYFIPRILNFLSSNIGLKFSTDLRLIMIMMYSVLPPLINPIIYCLRTEEVKKVL 1518075

Query:     305 KR 306
               ..
Sbjct: 1518076 RQ 1518081

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  151 bits (381), Expect = 2e-035
 Identities = 88/294 (29%), Positives = 142/294 (48%), Gaps = 2/294 (0%)
 Frame = -1

Query:    15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
             | | | || ||            |. |..|| ||. . |.   |||  |  . .|.| ||
Sbjct: 96155 FFLSGLSNVPH-AKYYYVFLSLVYVATVLGNSFIMCVIYMSRRLHTAKYIVVFHLAFSDL 95979

Query:    75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
             | ... || ..       . |||  |.   .|       . . |.||.|||  |.| || 
Sbjct: 95978 CGSSTVIPNVIDTFLFDHQEISYEACLANTFFTYHFMNLQSLTLLVMAYDRLVAICFPLQ 95799

Query:   135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
             |  ..       .    |.   |. ..       .  |    .| .||.   . ||.| |
Sbjct: 95798 YHAIVTNAAMFSILGGMWIFSVTHFSVFVGLLNRLSFCKSNVIDSYFCDYSLINRLACND 95619

Query:   195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
               || . . |   . .  |||||  ||  |  |. ..       |   || .||| |..|
Sbjct: 95618 NSVNIMMVKINFGLLICTPLILIFISYFCISLALFKIAHGVDRAKAIKTCTSHLMLVAIF 95439

Query:   255 FIPAMCIYLQPPSGNSQDQGKFIALFYT-VVTPSLNPLIYTLRNKVVRGAVKRL 307
             ||| .   .   . .     . |    |  . | |||.||||.   |  .|| |
Sbjct: 95438 FIPFLSNQIAILTTSVHLNTRLINSSLTQAIPPMLNPIIYTLKTDEVMQSVKEL 95277

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  148 bits (372), Expect = 3e-034
 Identities = 87/294 (29%), Positives = 142/294 (48%), Gaps = 2/294 (0%)
 Frame = -1

Query:     15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
              | | | || ||            |..|..|| |..   ||   |||  |  . .|.| ||
Sbjct: 100649 FFLSGLSNVPH-VKYYYVFLSLVYVVTVLGNSFLMCTIYLARRLHTAKYIVVFHLAFSDL 100473

Query:     75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
              | ... ||. .       . |||  |.   .|.      . . |.||.|||  |.| |||
Sbjct: 100472 CGSSAVIPKTIDTFLFDHQDISYEACLANTFFIYHFLNIQSLTLLVMAYDRLVAICFPLH 100293

Query:    135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
              |  ..      |.    |.   |. ..       .  |    .| .||.   . ||.| |
Sbjct: 100292 YHAIITKAAMFLILGGMWIFSVTHISVFVGLLNRLSFCRSTVIDSYFCDYSLINRLACND 100113

Query:    195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
                .| | . |   . .  |||||  ||  |  |. ..       |   || .||| | . 
Sbjct: 100112 NSLNILMIKINFGLLLCAPLILIFVSYFCISLALFKIAHGADRVKAIKTCTSHLMLVVVG 99933

Query:    255 FIPAMCIYLQPPSGNSQDQGKFIALFYT-VVTPSLNPLIYTLRNKVVRGAVKRL 307
              . | .   .   .       . |    | |. | |||.||||.   |  ..| |
Sbjct:  99932 YTPLISNQIAVLTAPMPANIRLINNCLTQVIPPMLNPIIYTLKTDEVMQSIKEL 99771

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  143 bits (360), Expect = 7e-033
 Identities = 85/294 (28%), Positives = 140/294 (47%), Gaps = 2/294 (0%)
 Frame = -1

Query:    15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
             | | ||||.||            | .|.. | ||. . ||   |||  |  . .|.  ||
Sbjct: 84233 FFLNGFSNFPH-AKYYYLFLSLVYAVTVLENSFIMCIIYLSRRLHTAKYIAVFHLALCDL 84057

Query:    75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
             | ... ||...       . |||| ||  .         . . |.||.|||  |.| || 
Sbjct: 84056 CGSSAVIPKVVDTFLFDHQDISYAACMANI......MNVQSLTLLVMAYDRLVAICFPLR 83877

Query:   135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
             |  ..      |.    |       ..       .  |    ....||.   . ||.| |
Sbjct: 83876 YHEIVTKTSMLLILGVIWTFSLIFFSVFVDSINRLSFCRTNVINNYFCDYCTVYRLACND 83697

Query:   195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
               .| |   . . . .  ||||.  ||  |  |. ..       |   ||  ||| |..|
Sbjct: 83696 NSINILMGKLGNDLLIFTPLILVFISYFCISLALFKIAHAVDRTKAIKTCTTHLMLVAIF 83517

Query:   255 FIPAMCIYLQPPSGNSQDQGKFIALFYT-VVTPSLNPLIYTLRNKVVRGAVKRL 307
             .|| .   .   .       . |    |  . | |||.||||.   |  .|| |
Sbjct: 83516 YIPILSNNIAALTTPFTSDIQIINNSLTQTIPPMLNPIIYTLKTDEVMQSVKEL 83355

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  142 bits (356), Expect = 2e-032
 Identities = 83/294 (28%), Positives = 145/294 (49%), Gaps = 2/294 (0%)
 Frame = -1

Query:    15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
             | | | || ||            .. |..|| |..   ||   |||  |  . .|.| ||
Sbjct: 90140 FFLNGLSNVPH-VKYYYMFLSLVHVATVLGNSFLMSTIYLARRLHTAKYIVVFHLAFSDL 89964

Query:    75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
             | ... .|...       . | |  |.  ..||    . . . |....|||  |.| || 
Sbjct: 89963 CGSSTVVPKIIDTFLFEHQDILYEACLANMFFVYFFMSMQSLTLLILAYDRLVAICFPLR 89784

Query:   135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
             |  ..      |.  | |.   |  ..       .  ||   .| .||.   . .|.| |
Sbjct: 89783 YHAIVTKPSMFLIIGAMWIFSLTYFSVLVGLVNRISFCGSNVIDSYFCDHGLIYKLACND 89604

Query:   195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
               .| |   .|  . .  |||||  ||  |  |.|..       |   || .||| |.. 
Sbjct: 89603 ISINLLMGKMTFGLLMCTPLILIFLSYFFIALALLKIAHGGARIKAMKTCTSHLMLVAIG 89424

Query:   255 FIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPS-LNPLIYTLRNKVVRGAVKRL 307
             . | .   .   . .     .        | || |||.||||. . |  ..| |
Sbjct: 89423 YFPLISNQIAALTTSIDPNTRIFNNSLRQVIPSMLNPIIYTLKTEEVMESMKDL 89262

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  141 bits (353), Expect = 4e-032
 Identities = 82/294 (27%), Positives = 141/294 (47%), Gaps = 2/294 (0%)
 Frame = -2

Query:     15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
              | | |||| |             | .|..|| ||. . ||   |||  |  . .|.  ||
Sbjct: 109183 FSLSGFSNMPQ-AKYYYMFLSLVYAVTVLGNSFIMCIIYLARRLHTAKYIVVFHLALSDL 109007

Query:     75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
              | ... ||...       . |||  |.  ..||      . . |. ..|||  |.| || 
Sbjct: 109006 CGSSALIPKIIEMFLFDHQDISYEACLTNMFFVYHFMNLQSLTLLALAYDRLVAICFPLQ 108827

Query:    135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
              |  ..      |.    |.   |  ..       .  |    .. .||.   .  |.| |
Sbjct: 108826 YHAIVTKSAMFLIIGVMWIVSVTFFSILVGLVNTISFCRSNVLNSYFCDYAPICGLACND 108647

Query:    195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
                .| |    .  . .  |||||  ||  |  |.||.       |   || .| | |...
Sbjct: 108646 ITINILIGKTSYGLLICTPLILIFISYFCISVALLRIAHGAERIKALKTCTSHFMLVAMY 108467

Query:    255 FIPAMCIYLQPPSGNSQDQGKFIALFYT-VVTPSLNPLIYTLRNKVVRGAVKRL 307
              ..| .   .   .       . |    |  . | |||.||||. . |  ..| |
Sbjct: 108466 YLPVLTNIIASATTPLHPNVQIINNSLTQAIPPMLNPIIYTLKTEEVMQSIKDL 108305

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  137 bits (344), Expect = 5e-031
 Identities = 78/272 (28%), Positives = 148/272 (54%), Gaps = 4/272 (1%)
 Frame = +2

Query:     38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
              |  |.. |. ....  ||. || ||| || ||.   |  ... .|... ||    | . |
Sbjct: 911306 YFTTVVANVTLMLVICLDASLHKPMYVFLFNLAINGLIGSSAVLPKIMDNLVDDIKDMLY 911485

Query:     98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                |.||.. .   ||    || .|.|||| ..|.|| |  .| |    ||   ..     
Sbjct: 911486 TDCIIQVFCINVYGTCAYALLTLMAYDRYVSICKPLQYHNIMTPGKIRLLLFIAYFVPIC 911665

Query:    158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
              .  .    |  .|.| .  ..  ||.  |.. |||      .|  .    .||..||| .
Sbjct: 911666 SLGIQVYLTSRLPVCRY-TINKLFCDNLAVVNLSCAKNPWADLYGICLVILFVVLPLIFV 911842

Query:    218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAM--CIYLQPPSGNSQDQGK 275
              . ||  |.   |.  | .  .|   ||  ||.    | . ..   || .     |..   
Sbjct: 911843 VFSYVQILFVSLK-ASVSAQRKALKTCTPHLITFINFSLASLFSVIYNRFNFSLSKEVNV 912019

Query:    276 FIALFYTVVTPSLNPLIYTLRNKVVRGAVKRL 307
              |... . .. | |.|||| .| | .  .. ..
Sbjct: 912020 FMSVHFILIPPLLHPLIYGIRTKEINNSIAKI 912115

>Zv7_masked||Zv7_scaffold1549 |chr15|Len:61801|start:45659510|end:45721310

          Length = 61801

 Score =  137 bits (343), Expect = 6e-031
 Identities = 84/298 (28%), Positives = 141/298 (47%), Gaps = 8/298 (2%)
 Frame = +2

Query:    15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
             |.| ||                 ||. |.||  .. .      ||.||| |.| |. .|.
Sbjct: 49883 FLLTGFPEIYKYRRFLFLPFFLTYLLLLVGNSLLLFVIKSTESLHSPMYIFVSALAVVDI 50062

Query:    75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
               .|. || .|.        |. .||. |..      . |  .|. |. ||. |.|.|||
Sbjct: 50063 IVSTAIIPAMLLGFLFDLNEITLSGCLTQMFVTHFFSSVESTILLAMALDRFVAICKPLH 50242

Query:   135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
             |  .|.      | . . .   |  .   .    .  ||   . | .|.  ||. |.|  
Sbjct: 50243 YNEIMNSSMFLKLFLFTLIRSGTIMSTLVALASPLSFCGSNVIYHCYCDHMALVSLACDS 50422

Query:   195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
                |.   .|    || |   .|  ||  |.  ||   .     | | ||| ||| .  |
Sbjct: 50423 IAQNQTMGLIVIICFVGIDTSVIFFSYVKILHVVLGTAAGEDRWKAFHTCGTHLMVMICF 50602

Query:   255 FIPAMCIYLQPPSGNSQ-----DQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAVKRL 307
             .      .|   | |       |   |. . | |   |.||.|| .| | .| |. ..
Sbjct: 50603 YFVGSVTFL---SRNLNIPIPIDVNTFLGVMYIVFPASVNPIIYGVRTKEIRTALFKI 50767

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  137 bits (343), Expect = 6e-031
 Identities = 78/266 (29%), Positives = 132/266 (49%), Gaps = 3/266 (1%)
 Frame = +3

Query:    38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLW--GPEKTI 95
             |.  .| |  .| |   | .|| ||.|   ||   |.  ||  .|.||...     |. |
Sbjct: 10329 YVFAMISNAGLIFLISTDKNLHEPMHFLFCNLPLNDIIGTTVVMPRLLLDILRETSERFI 10508

Query:    96 SYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSG 155
             ||| |..| |||     |   .|..|..||| |.| || || .|  .   .|.   |   
Sbjct: 10509 SYAECVVQAYFVHIFTAACHYVLMIMAFDRYVAICNPLRYTAIMTNKMVIVLSAIVWSLA 10688

Query:   156 FTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLI 215
                  .    |  .  | .. ... ||.  .| .||| .  || .  .. . .   .  .
Sbjct: 10689 VLLVTIMLGLTIRLSHCRYK-IENPFCDNASLFKLSCENVSVNNVFGLVYTVVVFSLSAL 10865

Query:   216 LILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGK 275
              |. .|  |    .  ..     |   ||  ||    . ||               |  |
Sbjct: 10866 SIVVTYVKIATVCVTSKNKALNSKAIKTCSTHLAVYLIMFISGATFIFLHRFPEYSDNRK 11045

Query:   276 FIALFYTVVTPSLNPLIYTLRNKVVR 301
               .. . || | ||||.| |.|| .|
Sbjct: 11046 LASIMFHVVPPGLNPLVYGLQNKEIR 11123

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  136 bits (342), Expect = 8e-031
 Identities = 89/297 (29%), Positives = 145/297 (48%), Gaps = 8/297 (2%)
 Frame = +2

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||.    | ||   |             |.. |. | |..     .  || ||.  | 
Sbjct: 1415672 NVSSD--LSLQGFDLSPEKAIIAFFFAIVNYIIILLCNSFLLFTIISNKALHEPMHILLL 1415845

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||   ||  .|   | ..  |    .|.|.. |. | .|.     .   .|  |.|||| 
Sbjct: 1415846 NLPINDLIGSTCLFPHVMRELLFDTRTMSFSVCITQAFFIHVYAVSAVFILAAMAYDRYV 1416025

Query:     128 AVCRPLHYTVLMHPRFCHLLAVAS--WVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVP 185
               |.|.|. || .|     ||  . |  |.|     |.       .| |    ..| .|. |
Sbjct: 1416026 AICQPMRYTTIM--TNIHLAKIISLVWLSNLILMAVLFILLLRLPRC-RSFLNHPYCDNP 1416196

Query:     186 ALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCG 245
               .||.| | || .| .  .. ...  .  | ||. ||  |. |  | . .    |   |||
Sbjct: 1416197 SLLQLVCADTTINNIYGLLMTAVSQVCSLGLIMYSYLRILIACFRNKRSDTRSKALQTCG 1416376

Query:     246 AHLMAVSLF-FIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                ||.   ||  .    |        |    ||||.   .. |..||.|| || | .|
Sbjct: 1416377 THLVVFGLFECLGLFTIISYRIKDISIHLRKFIAVAAMILPPTMNPVIYGLRTKEIR 1416547

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  136 bits (341), Expect = 1e-030
 Identities = 71/296 (23%), Positives = 145/296 (48%), Gaps = 2/296 (0%)
 Frame = -3

Query:      14 YFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLD 73
               || . | |   .            |.. .|||  ....  |.  ||.| |  . ||.  |
Sbjct: 1507430 YFFITGLSGTEY-SNYYYIFLFFLYIVAVIGNFIVLLIIALERSLHSPKYIAVFNLALAD 1507254

Query:      74 LCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPL 133
               .    . .| ..       . |||  ||. ..||    | .   ||||||||. |.| ||
Sbjct: 1507253 IGEMNALVPNMIKMFLFESQYISYNACMVNMFFVHFFTTMQSFTLVVMSYDRFVAICLPL 1507074

Query:     134 HYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCV 193
                |  ...     .. .  |        .       . .|    .  .. .   . .|.| 
Sbjct: 1507073 RYHAIVNNTVISVVFLVLWAFNVFVLLVVVGMITRLSICKSNVILSYYGDHGPVYKLACN 1506894

Query:     194 DTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSL 253
               |  .|     ........ |||.|  ||  .  |. .. .  |  |   || |||.    
Sbjct: 1506893 DNSINSFLGKLSTALYLVAPLIIIFLSYVGVFLALSKITTWEGRLKALKTCVAHLLLAGS 1506714

Query:     254 FFIPAMCIYLQPPSGNSQDQGKFIALFYT-VVTPSLNPLIYTLRNKVVRGAVKRLM 308
               ||.|   ||.     .     . ..   . |. |.|||..| |    ..  .|...
Sbjct: 1506713 FFVPIFSIYIASIMNSLTPNARVLSTSLSYVLPPTLNPILYVLNTAEIKQLIKKII 1506546

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  136 bits (341), Expect = 1e-030
 Identities = 89/297 (29%), Positives = 145/297 (48%), Gaps = 8/297 (2%)
 Frame = +1

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||.    | ||   |             |.. |. | |..     .  || ||.  | 
Sbjct: 1420765 NVSSD--LSLQGFDLSPEKAIIAFFFAIVNYIIILLCNSFLLFTIITNKALHEPMHILLL 1420938

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||   ||  .|   | ..  |    .|.|.. |. | .|.     .   .|  |.|||| 
Sbjct: 1420939 NLPINDLIGSTCLFPHVMRELLFDTRTMSFSVCITQAFFIHVYAVSTVFILTAMAYDRYV 1421118

Query:     128 AVCRPLHYTVLMHPRFCHLLAVAS--WVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVP 185
               |.|.|. || .|     ||  . |  |.|  |  |.       .| |    ..| .|. |
Sbjct: 1421119 AICQPMRYTTIM--TNIHLAKIISLVWLSNLTLMAVLFILLLRLPRC-RSFLNHPYCDNP 1421289

Query:     186 ALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCG 245
               .||.| | || .| .  .. ...     . ||. ||  |. |  | . .    |   |||
Sbjct: 1421290 SLLQLVCADTTINNIYGLLMTAVCQAFTVGLIIYSYLHILIACFRNKRSDTRSKALQTCG 1421469

Query:     246 AHLMAVSLF-FIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                ||.   ||  .    |        |    ||||.   .. |..||.|| || | .|
Sbjct: 1421470 THLVVFVLFECLGLFTIISYRIKDISIHLRKFIAVAAMILPPTVNPVIYGLRTKEIR 1421640

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  135 bits (338), Expect = 2e-030
 Identities = 79/297 (26%), Positives = 138/297 (46%), Gaps = 4/297 (1%)
 Frame = +1

Query:     8 NASSEGYFILV-GFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFL 66
             | .   | .|| |    |             |.  .. |. .|.|   . .|| ||.|  
Sbjct: 49114 NLTITNYTLLVEGLKVAPQSSYPVFILLLLVYVFIMVSNIGLIVLISTEKNLHHPMHFLF 49293

Query:    67 SNLSFLDLCYTTSSIPQLLVNLW--GPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYD 124
              ||   |.  |   .|.|. ..     |. |||| |..| |||     |   .|..|..|
Sbjct: 49294 CNLPLNDIIGTNVILPRLMQDMLRDSSERYISYAECVVQAYFVHLFAIACHYVLIIMAFD 49473

Query:   125 RYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEV 184
             || |.| || || .|  .    |. ..|       ..    |  .  |    ... ||. 
Sbjct: 49474 RYVAICNPLRYTAIMTNKMVVKLSASAWGLSIFMVSILLGLTIRLSRC-RSYIENPFCDN 49650

Query:   185 PALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTC 244
              .| .|||    .| .  |. | |   . |  .  .|| |    .  .. .   |   ||
Sbjct: 49651 ASLFKLSCESVIINNIFGMVYSVIVFTLSLGSLFVTYGKIASVCITSKNKSLNSKAIKTC 49830

Query:   245 GAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
               |.    . ||               |  |  .. . .| | ||||.|  . | .|
Sbjct: 49831 STHIAVYLIMFISCASFIFLHRVPEYSDTRKLASIMFHIVPPGLNPLVYGFQTKEIR 50001

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  133 bits (334), Expect = 7e-030
 Identities = 73/267 (27%), Positives = 137/267 (51%), Gaps = 4/267 (1%)
 Frame = +2

Query:    38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLW--GPEKTI 95
             ||  .  |. ..|.   . .|| ||.|   ||   |.  .|  .|.|| ..     |. .
Sbjct: 33368 YLFIMGCNIGLVIVILTEKNLHHPMHFLFFNLPLNDIIGSTVIMPRLLQDILREASERYM 33547

Query:    96 SYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSG 155
             .|  |..| |||     |   .|..|..||| |.| || || .|  .    |.  .|   
Sbjct: 33548 TYVECVVQAYFVHIFAAASHYVLLIMAFDRYMAICNPLRYTAIMTNKMVVKLSALAWGWS 33727

Query:   156 FTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLI 215
               .  .  | |  .  |    ... ||.  .| .||| |  || .  . |. .  .  | 
Sbjct: 33728 VISVTILISLTLRLSRC-RSNIENPFCDNASLFKLSCEDVVVNNVYGICTTILVSVFSLG 33904

Query:   216 LILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPA-MCIYLQPPSGNSQDQG 274
              .  .|  |    .  .. .  .|   ||| |.    . |. . . ..|        |  
Sbjct: 33905 SVFITYAKIATVCITSKNKSFNRKAIQTCGTHIAVYLIMFVSSVIMVFLHRSPPQYSDSR 34084

Query:   275 KFIALFYTVVTPSLNPLIYTLRNKVVR 301
             |  .. . .| | ||||.| |. | .|
Sbjct: 34085 KLASIMFHIVPPGLNPLVYGLQTKEIR 34165

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  133 bits (333), Expect = 9e-030
 Identities = 93/303 (30%), Positives = 143/303 (47%), Gaps = 7/303 (2%)
 Frame = +3

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | |.   | | | .                | . .  |. .|.  .|   || ||| || 
Sbjct: 1037604 NESNVFVFALSGLNETMENRYVLLSFTALFYPVVIFCNVTVILTIFLHKKLHEPMYIFLC 1037783

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||    .  |.   |. . .|  ||  ||||||.||.. . .    .   | ||.|||| 
Sbjct: 1037784 NLCINGIFGTSGFYPKFMYDLLAPEHVISYAGCLIQIFVIYSSVFCDFSTLTVMAYDRYV 1037963

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|||| |  .|  .      .  |.| |   |.       . ||| | ..  .||.  .
Sbjct: 1037964 AICRPLEYHSMMTNQKILKCVLFCWLSPFFCMAVLILLIARLTLCGFR-IEKLYCEIWGV 1038140

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
                .|||  | .| .   |    .|    |||  ||  ...     .|     |   ||  |
Sbjct: 1038141 AKLSCFSTTLNNVFGYIVIIAYV-GHAILIFCSYIYLIRKC--QKSIESRHKFMQTCVPH 1038311

Query:     248 ---LMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                  |. |.. |.  .          ||.   |.|| . .. | |||||| |    ||  |
Sbjct: 1038312 MISLLNVTVAFLFDVLFSRYGSKNVSQNLRNFMALEFILIPPFLNPLIYGLNLTAVRQEV 1038491

Query:     305 KRL 307
                ||
Sbjct: 1038492 IRL 1038500

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  132 bits (332), Expect = 1e-029
 Identities = 73/274 (26%), Positives = 133/274 (48%), Gaps = 3/274 (1%)
 Frame = +3

Query:    38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLW--GPEKTI 95
             |.  .. |. .|.|   . .|| ||.|   ||   |.  |   .|.|. ..     |. |
Sbjct: 27240 YVFIMVSNIGLIVLISTEKNLHHPMHFLFCNLPLNDIIGTNVILPRLMQDMLRESSERYI 27419

Query:    96 SYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSG 155
             ||| |..| |||     |   .|..|..||| |.| || |. .|  .    |. ..|   
Sbjct: 27420 SYAECVVQAYFVHVFAVACHYVLMIMAFDRYVAICNPLRYSAIMTNKMVVKLSASAWGLS 27599

Query:   156 FTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLI 215
                 ..    |  .  |    ... ||.  .| .|||    .| .  |. . |   . | 
Sbjct: 27600 IFIVSILLGLTIRLSRC-RSYIENPFCDNASLFKLSCESVIINNIFGMVYTVIVFTLSLG 27776

Query:   216 LILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGK 275
              .  .|| |    .  .. .   |   ||  |.    . ||               |  |
Sbjct: 27777 SLFITYGKIASVCITSKNKSLNSKAIKTCSTHIAVYLIMFISCASFIFLHRVPEYSDTRK 27956

Query:   276 FIALFYTVVTPSLNPLIYTLRNKVVRGAVKRLMG 309
               .. . .| | ||||.| |. | .|    .  |
Sbjct: 27957 LASIMFHIVPPGLNPLVYGLQTKEIRQKFVKFWG 28058

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  132 bits (331), Expect = 2e-029
 Identities = 85/304 (27%), Positives = 147/304 (48%), Gaps = 3/304 (0%)
 Frame = -2

Query:      5 GKVNASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYF 64
              |  | |.  || . |||  ||            |..|..||  .. .  .| .|||| | 
Sbjct: 124486 GNGNVSTPSYFYISGFSGIPH-MRYYYIFLFFIYIITVLGNSCLMSVIIMDRNLHTPKYI 124310

Query:     65 FLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYD 124
               . |||  |.| .|. |||||       . . |  ||  .. ||.    . . | |.|.|
Sbjct: 124309 AVFNLSLTDICESTAVIPQLLDTFLFVNQLMPYGLCMSSMFSVLSFLAMQSLTLTVLSFD 124130

Query:    125 RYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCG-HRQVDHFFCE 183
              |  |.  || | ...  |    .  | |      . . . |   .  |     |. |.|.
Sbjct: 124129 RLVAISLPLRYHMIVTHRLMFFIIGALWTLALLLTIIGAIFMSRLSFCKVIVTVNSFYCD 123950

Query:    184 VPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGT 243
                 . | .| .   . .   .  .| .  |   |. ||  |   . |. .    |.   |
Sbjct: 123949 HGPIYRSACNNNFPSSVIASLFPAIILGFPAFFIIFSYTCIAVTLFRITTPQDRQRATKT 123770

Query:    244 CGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGA 303
              | |||. |..|..|    |      ..  .   ..|  . . | |||.|||        |
Sbjct: 123769 CTAHLILVAVFYLPITFTYAFWSFIDTNTRIINLSL-TSALPPMLNPIIYTFMT*EFMVA 123593

Query:    304 VKRL 307
              ||||
Sbjct: 123592 VKRL 123581

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  131 bits (328), Expect = 3e-029
 Identities = 73/266 (27%), Positives = 132/266 (49%), Gaps = 3/266 (1%)
 Frame = +3

Query:    38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLW--GPEKTI 95
             |.  .  |. .|||   . .|| ||.|   ||   |.  ||  .|.|| ..     |. |
Sbjct: 45948 YIFAMGCNIGLIILISTEKNLHHPMHFLFCNLPLNDILGTTVMLPRLLQDILREASERYI 46127

Query:    96 SYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSG 155
             .|  |..| |||     |   .|..|..||| |.| || |. .|  .    |.|..|   
Sbjct: 46128 TYVECVVQAYFVHIFAAASHYVLMIMAFDRYVAICNPLRYSAIMTNKMVVKLSVSAWGLS 46307

Query:   156 FTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLI 215
                 ..    |  .  | .. ... ||.  .| .||| .  .| .  .| . |     | 
Sbjct: 46308 VFIVSIMLGLTIRLSRCRYK-IENPFCDNASLFKLSCENVSINNVFGLIYTVIVFTFSLG 46484

Query:   216 LILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGK 275
              .  .|  |    .  ..     |   ||| |.    . |     .          |  |
Sbjct: 46485 SVFITYTKIAAVCITSKNKALNSKAIKTCGTHIAVYIIMFASCATMVFLHRFPEYSDNRK 46664

Query:   276 FIALFYTVVTPSLNPLIYTLRNKVVR 301
               .. . .| | ||||.| |. | .|
Sbjct: 46665 LASIMFHIVPPGLNPLVYGLQTKEIR 46742

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  130 bits (325), Expect = 7e-029
 Identities = 79/265 (29%), Positives = 124/265 (46%), Gaps = 2/265 (0%)
 Frame = -1

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||  |  || |.|   |.  || |||  | |.   |    |.   ||| ..|  . .|||
Sbjct: 1411474 YLFILFCNLTIVITICLNRSLHKPMYILLLNMPINDTMAATNFFSQLLYSIWSQDTSISY 1411295

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                 |..| . |   | |  |.|  |.|||| |.| || |  .|.      .    ||  ||
Sbjct: 1411294 PACLLQGFIVHLYGGASYVILTAMAYDRYIAICCPLRYGAIMNSNNLIKIITGMWVFNFT 1411115

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                  .  |      .|     |  ||  |....| | || || .  .|.  ..  | | ..
Sbjct: 1411114 VITVLFSLLLPYKICRTHMTD-LFCYNPSIMKLMCEDTTVNNIIGLISLVLYHCIALSVV 1410938

Query:     218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMA-VSLFFIPAMCIYLQPPSGNSQDQGKF 276
                 .|  |.   .  . .    |   ||| ||.  . | |     .             . 
Sbjct: 1410937 AFTYIHILITCVTNKQSDAKMKALQTCGTHLVVFLFLEFNTLFPLVAHRSESVPAYLRRV 1410758

Query:     277 IALFYTVVTPSLNPLIYTLRNKVVR 301
                ..   |  | .|||.|  . | .|
Sbjct: 1410757 FSITVFVFPPIINPLVYGFKTKEIR 1410683

>Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|end:32655019

          Length = 557194

 Score =  128 bits (321), Expect = 2e-028
 Identities = 76/288 (26%), Positives = 140/288 (48%), Gaps = 4/288 (1%)
 Frame = +1

Query:     16 ILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLC 75
              .. | |  |             |.  .. ||.|..   .|  || |||   |||   |. 
Sbjct: 345631 LVEGLSVSPPYSYVAFFSLLTVYIFIMVSNLWILLNIMIDKDLHQPMYSIYSNLPLRDVI 345810

Query:     76 YTTSSIPQLLVN-LWGP-EKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPL 133
               |.  .|.|| . |  | |. |.|  | .| .|.   |||   .|..|..||| |.| ||
Sbjct: 345811 GTSVIVPRLLRDVLTNPSERYITYVECALQAFFIHLNGTACHTILMIMAFDRYVAICNPL 345990

Query:    134 HYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCV 193
               |. .|  .    |.  .|.|      .  | .  .  |    . . ||.  .| .||| 
Sbjct: 345991 RYSAIMSNKMVIKLSAGAWISMSVMVGIMISLSVRLSHC-RSLIQNHFCDNASLFKLSCE 346167

Query:    194 DTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSL 253
               | .| .  .  .   ... .  |  .|  |    .  ..    .|   ||  ||.  ..
Sbjct: 346168 STEINNIYGLTFTVSVIVVSMGSISLTYLRIAIVCISSKNKRN-KKAITTCSTHLIVYTI 346344

Query:    254 FFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                .               .  .  .. ..|| | |||||| |. | .|
Sbjct: 346345 MLVSGFVAVFLHRFSEYYENRRIASIVFSVVPPGLNPLIYGLQVKEIR 346488

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  127 bits (318), Expect = 5e-028
 Identities = 87/297 (29%), Positives = 137/297 (46%), Gaps = 7/297 (2%)
 Frame = +2

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||   | |   |                | . .  |. .|.  .|   || ||| |. 
Sbjct: 1042889 NESSVSVFTLSALSETMENRYVLLTFTALFYPLVVFCNVTVILTIFLHKKLHEPMYVFIC 1043068

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||    .  |.   |. . .|   .. |||||||||.  . .    .   | ||.|||| 
Sbjct: 1043069 NLCVNGVYGTSGFYPKFMYDLLAQDQVISYAGCMIQILVIYSYLICDFSTLTVMAYDRYV 1043248

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|||| |  .|  .      .  |.    . .        .||||   ..  .||. |.
Sbjct: 1043249 AICRPLEYHSIMTNQKIFKCILFCWLPAIFSISFLILLLVRLPLCG-STIEKLYCEIWAV 1043425

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
                .|||| | || .   |    .     .|.  ||  ...     .|     |   ||  |
Sbjct: 1043426 AKLSCVSTTVNNVFGFIVILTY-FGHAVLVFCSYIYLMRKC--RKSIEDKNKFIQTCVPH 1043596

Query:     248 LMAVSLFFIPAMCIYLQPPSGNS---QDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
               ..|.    |  .   |    |     |    |.|. . .| | |||||| |. | ||
Sbjct: 1043597 ILALMNVTIAMLFDVLFTRYGTKNVPQSLRNFMAMEFLLVPPILNPLIYGLKMKTVR 1043767

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  127 bits (317), Expect = 6e-028
 Identities = 84/294 (28%), Positives = 140/294 (47%), Gaps = 13/294 (4%)
 Frame = +3

Query:      15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
               |  . | |  .            | . .. |. |..  .|.  || |||  .| ||   |
Sbjct: 1004292 FNFMWFENLGYIRYALFILGFILYFVIILFNVLIMLAVFLERTLHQPMYILISCLSINSL 1004471

Query:      75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
                 |    |..| .|     .||   |. | . .      |  .|..|..||| |.|.|||
Sbjct: 1004472 FGTAGFFPRVLSDLLSETHSISREACIFQCFVIFTYAANEFSILMLMAFDRYVAICKPLH 1004651

Query:     135 YTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD 194
               |  .. |||   | | .     |   . |  |  . .||.. .   .|    ...||| .
Sbjct: 1004652 YHSIVRPRFLACLIVLNLTVPMTLIGVGSLLTTNLKMCGNK-LFKVYCHTYEVVKLSCDN 1004828

Query:     195 THVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLF 254
                 .|    . |     .||.| || ||  |.  . .  |     | | ||  |.. .  |
Sbjct: 1004829 IVINNAFGLFTLITTSVIPIISILFSYVKIL-IICQRSSAQFKGKAFQTCIPHIVILLNF 1005005

Query:     255 FIPAMC-------IYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                |   |       . || | | |     |..| . .. | ||||||      .|
Sbjct: 1005006 TIAVTCDITLSRVVNLQIPVGLS----VFLSLEFLIIPPVLNPLIYAFNLPDIR 1005155

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  126 bits (315), Expect = 1e-027
 Identities = 79/302 (26%), Positives = 146/302 (48%), Gaps = 3/302 (0%)
 Frame = -3

Query:      8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
              | |   || . |||  ||            |... .||  .. .  .| .|||  |  . 
Sbjct: 118431 NISIPSYFYISGFSGIPH-MRYYYIFLSFVYIISFLGNSCLMFVIIIDRNLHTAKYIAVF 118255

Query:     68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
              |||  |.| .|. |||||       . | |  |.  .. |    . . . | |.|.||  
Sbjct: 118254 NLSLSDICESTAVIPQLLDTFLFRNQLIPYRLCLYNMFSVFVSISTQSLTLAVLSFDRLV 118075

Query:    128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCG-HRQVDHFFCEVPA 186
              |.| || | ...  |   ..   .|          . |   .  |     |. |.|.   
Sbjct: 118074 AICLPLRYHMIVTFRSMLVIIGLTWALTLLMVMTATIFISRLSFCKVIVTVNSFYCDHGP 117895

Query:    187 LLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGA 246
              . | .| .   . .   .   . . .|.  |. ||  |   . |. .    |.   || |
Sbjct: 117894 IYRSACSNNFPSSVIGSLYPIVILGLPVFFIIFSYTCIAVTLFRVTTPQDRQRATKTCTA 117715

Query:    247 HLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAVKR 306
              ||. |..|..|    |      |.  .   ..|  . . | |||.||| . .    .||.
Sbjct: 117714 HLILVAVFYLPITITYSLASIINTNTRIINLSL-TSALPPMLNPIIYTFKTEEFMVSVKK 117538

Query:    307 LM 308
              |.
Sbjct: 117537 LL 117532

>Zv7_masked||Zv7_scaffold2079 |chr21|Len:557194|start:32097826|end:32655019

          Length = 557194

 Score =  126 bits (314), Expect = 1e-027
 Identities = 73/294 (24%), Positives = 135/294 (45%), Gaps = 3/294 (1%)
 Frame = +1

Query:     16 ILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLC 75
              .. ||   |             |. |.. |. .|.|   . .|| ||.|   ||   |. 
Sbjct: 358033 LVEGFRVTPQSTYPVFILLLLAYVFTMVSNIGLIVLISTEKNLHHPMHFLFCNLPLNDII 358212

Query:     76 YTTSSIPQLLVNLW--GPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPL 133
               ||  .|.|....     |. |.|  |. | |||     |   .|..|..||| |.| ||
Sbjct: 358213 GTTVIMPRLMLDILKDTSERYITYMECVTQAYFVHIFIAACHYVLIIMAFDRYVAICNPL 358392

Query:    134 HYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCV 193
               |. .|  .    |. ..|        .    |  .  |   .... ||.  .| .||| 
Sbjct: 358393 RYSAIMTNKMVIKLSASAWGLAILLVTIMLGLTIRLSHC-RSKIENPFCDNASLFKLSCE 358569

Query:    194 DTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSL 253
                 .| .  .. .   .    . |  .|  |       .|     |   ||  ||    .
Sbjct: 358570 SVVINNIYGIVYTVAVLCFSAVSIFITYVKIAAVCKTSKSKALNSKAVKTCSTHLAVYLI 358749

Query:    254 FFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAVKRL 307
               |     .          |  |  .. . .. | ||||.| |. | .|  .  |
Sbjct: 358750 MFFSGATMTFLHRFPEYSDNRKLASIMFHIIPPGLNPLVYGLQTKEIRQKMTNL 358911

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  125 bits (312), Expect = 2e-027
 Identities = 82/271 (30%), Positives = 133/271 (49%), Gaps = 6/271 (2%)
 Frame = -2

Query:     42 LIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVN-LWGPEKTISYAGC 100
              .. ||||| . | .  || ||| || .|    || . .  | .| | |      .    |
Sbjct: 932655 IVANLFIIGIIYKEKSLHEPMYVFLCSLCANQLCGSFALFPFVLGNMLRSKTPEVPLTVC 932476

Query:    101 MIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSA 160
                |.. .   |  |   | .|||||| |.| || |  .| |     |    |       .
Sbjct: 932475 HAQIFALYTYGQVEFCNLAMMSYDRYVAICHPLEYHRIMSPARTMTLIALGWSLQIIIFS 932296

Query:    161 LHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTS 220
              |  |    . |||.  .|  .|.   |..|.| ||  | .  |   .. .  ||.||| |
Sbjct: 932295 LSFSVNVQLKLCGN-VLDKVWCDQYMLVKLACSDTTPNNIAGMTGIAVTIGAPLLLILFS 932119

Query:    221 YGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQG---KFI 277
              |  |..  |. .  |  ||   ||  ||...  | .      .|   |           .
Sbjct: 932118 YAKILRVCLKFKGQTA-QKSLYTCILHLISLLNFAVGCSFELIQSRFGKLPMPAVVRVIL 931942

Query:    278 ALFYTVVTPSLNPLIYTLRNKVVRGAVKRLM 308
              .|.. |  |  ||..| .|   .. |.|...
Sbjct: 931941 SLYFLVCPPLFNPIMYGVRLANIKKALKKMI 931849

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  123 bits (308), Expect = 7e-027
 Identities = 88/303 (29%), Positives = 138/303 (45%), Gaps = 7/303 (2%)
 Frame = +1

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||   | | |                  | . .  |. .|.       || ||| |. 
Sbjct: 1056622 NESSVSVFTLSGLDETMENRYVLFSLTVLFYPLMVFCNVTVIVAIISHKKLHEPMYVFIC 1056801

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||    |  |    |. | .|   .  ||||||||| . . .    .   | ||.|||| 
Sbjct: 1056802 NLCANALFGTAGFYPKFLYDLLSQDHVISYAGCMIQTFVIYSYALCDVSTLTVMAYDRYV 1056981

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|||| |  .|  .      .  |..     .|       . |||   ..  .||. |.
Sbjct: 1056982 AICRPLEYHSVMTSQRVVEWILFCWLAPLFCMSLLIVLLSRLVLCG-STIEKLYCEIWAV 1057158

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
                .|||    || .   .|  .      .||  ||  ...  ..  || | .|   ||  |
Sbjct: 1057159 AKLSCFSNTVNNV-FGLTVILVYFGHGVLIYCSYFQLIRKCVK--STEGRRKFMQTCVPH 1057329

Query:     248 LMAVSLFFIPAMCIYLQPPSGNS---QDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
               |...    .  .   |    |.         |.|| . .. | |||||| |   .||  |
Sbjct: 1057330 LLSLINVTVALLFDVLYSRFGSKNVPHSVRNFMALEFLLIPPILNPLIYGLNLTIVRQQV 1057509

Query:     305 KRL 307
                .|
Sbjct: 1057510 IKL 1057518

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  122 bits (305), Expect = 2e-026
 Identities = 86/303 (28%), Positives = 137/303 (45%), Gaps = 7/303 (2%)
 Frame = +2

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||   | |   .                | . .  |. .|        || ||| |. 
Sbjct: 1030112 NESSVLIFTLSALNETTENRYVLFSLTALYYPLIVFCNVTVIFTIISHKKLHEPMYVFIC 1030291

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               .|    |  |    |. | .|   .. ||| ||.||.. . .    .   | ||.|||| 
Sbjct: 1030292 SLCVNGLFGTVGFYPKFLYDLLSQDQVISYVGCLIQIFVIYSSLLCDFSTLTVMAYDRYV 1030471

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|||| |  .|  |      .  |.   .   |  . |  . |||   ..  .||  ..
Sbjct: 1030472 AICRPLEYHSVMTARMVFKCILFCWLPPMSCLCLLVTLTSRLTLCG-SSIEKLYCENWSV 1030648

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
               ..|||  | || .   .   |.     .|.  ||  ...     .|  |  |   ||  |
Sbjct: 1030649 VKLSCFSTTVNNVIGFVIIIIY-FTHAVLVFCSYMYLIRKC--RKSIEGRHKFIQTCVPH 1030819

Query:     248 LMA---VSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
               |..   |.  |.  .           |    |.|| . .. | |||||| |.   ||  |
Sbjct: 1030820 LLSLINVTTAFLFDVLFSRYGSKSVPQSLRNFMALEFLLLPPILNPLIYGLKLTAVRQEV 1030999

Query:     305 KRL 307
                ||
Sbjct: 1031000 MRL 1031008

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  122 bits (304), Expect = 2e-026
 Identities = 90/299 (30%), Positives = 143/299 (47%), Gaps = 15/299 (5%)
 Frame = +1

Query:     10 SSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNL 69
              ||  || |  |  . |            ||  .. |  |. . . .  || |||  .| |
Sbjct: 958831 SSSFYFTL--FKEFVHIRYVILTLTLTVYLAIIVCNAIILFVVFKERSLHEPMYILISCL 959004

Query:     70 SFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAV 129
              |  ||  .    |.|. .|      ||   | .|.. . .   .|  .| .|.|||| |.
Sbjct: 959005 SVNDLYGSAGFFPRLIADLLSDTNAISRPACFVQIFTIYSYAMSEYTILTLMAYDRYVAI 959184

Query:    130 CRPLHYTVLMHPRF-CHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALL 188
              | || |  .|  |     .|.||.   | . ||   |.  .||||   |   .|   ...
Sbjct: 959185 CNPLKYHKIMSLRLTARYMAMASFCVVF-SMALVIFFSAKLPLCG-TDVTRLYCSNWSVV 959358

Query:    189 RLSC-VDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
              ||||   |  | .     ..  | .|   || .|  |.  . .  |     |   ||  |
Sbjct: 959359 RLSCGTSTLSNNILGFFVTTATVFLPAFFILYTYIRIL-IICQKSSKEFKGKALQTCLPH 959535

Query:    248 LMAVSLFFIPAMC-IYLQPPSGNSQDQGKFIALFYT----VVTPSLNPLIYTLRNKVVR 301
              ...   . | . | | |   | |  |. | . . ..    |. | |||||| |    .|
Sbjct: 959536 IVSFVNYSIASFCDIAL---SRNDSDKIKILTIIFSVEFLVIPPVLNPLIYGLNLPEIR 959703

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  122 bits (304), Expect = 2e-026
 Identities = 92/308 (29%), Positives = 139/308 (45%), Gaps = 15/308 (4%)
 Frame = -3

Query:       4 DGKVNASSEGYFILVGFSNWPHXXXXXXXXXXX-XYLMTLIGNLFIIILSYLDSHLHTPM 62
               .|  | ||     .   ..|               ||.|.| |  .|..   .  || ||
Sbjct: 1388943 EGMENISSSHILTVTALNDWDWTSRILFFSFALPGYLLTIILNATLIMIIAFEKALHEPM 1388764

Query:      63 YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMS 122
               | || ||   |||  |   |. |  |      ||.  |..|   ..   | |   | ||.
Sbjct: 1388763 YIFLCNLCINDLCGITGFYPRALTYLLTERNVISHEECIVQGLVIVIYATGEFTSLSVMA 1388584

Query:     123 YDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFC 182
                ||| |.||||||  .|       |    ||       .  | |   |.| |  ..  ||
Sbjct: 1388583 VDRYIAICRPLHYHRIMSSFTVLSLVTFIWVFSCFVGLMAISLTLKYPICRH-NINKLFC 1388407

Query:     183 EVPALLRLSC----VDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQ 238
               |  .|| |.|     .  ||    .| | .||      .| ||  |. |    .|    .
Sbjct: 1388406 EHLSLLNLACKHDIFEGIVNGFIFIIMSFLFV-----FVLLSYLKIILAC--RKSKVSRE 1388248

Query:     239 KVFGTCGAHLMA-VSLFFIPAMCIYLQPPSGN-SQDQGKFIALFYTVVTPSLNPLIYTLR 296
               | | ||  ||.. ..     .  .| .      |  .  |...    | | |||||| ..
Sbjct: 1388247 KFFSTCIPHLISFLNTTCGLSDSLYTKFNIDTLSHVEHTFLSIIILTVPPFLNPLIYGIK 1388068

Query:     297 NKVVRGAV 304
                  .|  .
Sbjct: 1388067 LGPIRAKI 1388044

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  121 bits (303), Expect = 3e-026
 Identities = 78/271 (28%), Positives = 131/271 (48%), Gaps = 13/271 (4%)
 Frame = +2

Query:     38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
              |   .  |. |..  .|.  || |||  .| ||   |  |    |..| .|     .|| 
Sbjct: 976262 YFSIIFFNVLIMLAVFLERTLHQPMYILISCLSMNSLFGTAGFFPRVLSDLLSETHSISR 976441

Query:     98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                |  | . .      |  .|..|..||.||.|.||||  .. |||   . | .      
Sbjct: 976442 EACFFQSFVIFTYAANEFSILMIMAFDRFAAICKPLHYHSIVRPRFLACVIVTNLTFPMI 976621

Query:    158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                 .    |  . .||.. .   .|    ...||| .  .|    .    |  .||| ||
Sbjct: 976622 LLGVAGLLTTKLRMCGNK-LFKVYCHSYEIVKLSCDNIAINNAFGLFILIITTIIPLSLI 976798

Query:    218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMC-------IYLQPPSGNS 270
                ||  |.  . .  |     | | ||  |.. .  | |  .|       . || | | |
Sbjct: 976799 SFSYVKII-IICQRSSAQFKGKAFQTCIPHIVVLLNFTIAVICDTTLSRVVNLQIPVGLS 976975

Query:    271 QDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                   |..| . .. | ||||||      .|
Sbjct: 976976 ----VFLSLEFLIIPPILNPLIYAFNLPDIR 977056

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  121 bits (303), Expect = 3e-026
 Identities = 83/272 (30%), Positives = 131/272 (48%), Gaps = 7/272 (2%)
 Frame = +3

Query:     38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
              |   .  |. |.    .   || ||.||. ||    |  |    |. | .|   .  |.|
Sbjct: 969627 YPFIVFCNVTILYAVMMHKKLHEPMFFFICNLCVNALYGTVGFYPKFLYDLLSQDHVITY 969806

Query:     98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
              |||.||.. . .    .   | ||.|||| |.|||| |  .|  .      .  |.. | 
Sbjct: 969807 AGCLIQIFIIYSSVLCDISTLTVMAYDRYVAICRPLEYHSIMTDQRIVECILFCWLTPFF 969986

Query:    158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                 .    |  . |||   ..  .||  ....|||  | || .   .   ..     .||
Sbjct: 969987 CMTVLIGLTARLTLCG-SAIEKLYCENWSVVKLSCFSTTVNNVVGYVIIIVY-FGHAVLI 970160

Query:    218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNS---QDQG 274
                ||  |   |   .||    |   ||  ||.|.    .  .   |    |.    ||  
Sbjct: 970161 FCSY--IYLVVKCRKSTESRHKFIQTCVPHLLALLNVTVALLFDVLYSRYGSKSLPQDLR 970334

Query:    275 KFIALFYTVVTPSLNPLIYTLRNKVVRGAVKR 306
               |..| . .| | |||||| |    .|  | |
Sbjct: 970335 NFMSLEFLLVPPMLNPLIYGLNLTRLRREVMR 970430

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  121 bits (303), Expect = 3e-026
 Identities = 85/304 (27%), Positives = 135/304 (44%), Gaps = 13/304 (4%)
 Frame = -1

Query:       4 DGKVNASSEGYFILVGFSNWPHXXXXXXXXXXX-XYLMTLIGNLFIIILSYLDSHLHTPM 62
               .|  | ||    |.   ..|               ||.|.. |  .|..   .  || ||
Sbjct: 1384484 EGMENISSSHILIVTALNDWDWTSRILFFSFALPCYLLTIVLNATLIMIIAFEKALHEPM 1384305

Query:      63 YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMS 122
               | || ||   ||| ||   |. |  |      | .| |..| . ..     |   | ||.
Sbjct: 1384304 YIFLCNLCINDLCGTTGFYPRALTYLLTERNVILHAECIVQGFVIIVFSIGEFTNLSVMA 1384125

Query:     123 YDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFC 182
                ||| |.||||||  .| |     |    ||   .  |.  | |   ||| |  ..  ||
Sbjct: 1384124 VDRYIAICRPLHYHRIMSPFTVLSLVTFIWVFPCSVGAMSISLTLKYPLCRH-DINRIFC 1383948

Query:     183 EVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLR--MQSTTGLQKV 240
               |  .|| |.|            | . || | . .           ..    .|    .| 
Sbjct: 1383947 ENLSLLNLACKQDFFQG-----TFNGFVYISMGV..........KIILACRKSKVSREKF 1383783

Query:     241 FGTCGAHLMA---VSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRN 297
               . ||  ||..    .     ..|   .  .  |     |...    | | .||.|| .. 
Sbjct: 1383782 YSTCIPHLISFLNTTCGLSDSVCTQFKVET-LSHVVYTFLSIINLTVPPIVNPVIYGIKL 1383606

Query:     298 KVVR 301
                 .|
Sbjct: 1383605 GPIR 1383594

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  121 bits (302), Expect = 3e-026
 Identities = 91/305 (29%), Positives = 139/305 (45%), Gaps = 11/305 (3%)
 Frame = +1

Query:       8 NASSEGYFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLS 67
               | ||   | | | .                | . .  |. ..     .  || ||| |. 
Sbjct: 1049509 NESSVSVFKLSGLNETMENRIVFFSFTALFYPLMVFCNVTVMFTIMSNKKLHEPMYMFIC 1049688

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||    |  |.   |. | .|   .  ||| ||.||.. . .    .   | ||.|||| 
Sbjct: 1049689 NLCVNGLFGTSGFYPKFLYDLLAHDHVISYVGCLIQIFVIYSSALCDFSTLTVMAYDRYV 1049868

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|||| |  .|  |      .  |.. |   ..       . ||    ..  .||. |.
Sbjct: 1049869 AICRPLEYHSIMTSRMILKCILFCWLAPFVCMSVLIVLIARLTLCA-STIEKLYCEIWAV 1050045

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
                .|||  | .| .   |    .     .||  ||  ...    |.|     |   ||  |
Sbjct: 1050046 AKLSCFSTTINNVFGYIVILTY-FGHAVLIFCSYIHLIKKC--MKSIEVRHKFIQTCVPH 1050216

Query:     248 LMAVSLFFIPAM----CIYLQPPSGN-SQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRG 302
               |.  ||  . |      .| .  | |  |    |.|| . .| | |||||| |    || 
Sbjct: 1050217 LL--SLINVTAALLFDVLYSRYGSRNLPQSVRNFMALEFLLVPPILNPLIYGLNLTAVRQ 1050390

Query:     303 AVKRL 307
                | ||
Sbjct: 1050391 QVIRL 1050405

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  120 bits (300), Expect = 6e-026
 Identities = 82/273 (30%), Positives = 130/273 (47%), Gaps = 14/273 (5%)
 Frame = -3

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||.|.. |  .|..   .  || ||| || ||   |||  |   |. |  |      || 
Sbjct: 1386735 YLVTIVLNATMIMIIAFEKALHEPMYIFLCNLCINDLCGITGFYPRALTYLLTERNVISL 1386556

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                 |..|   ..  |  |   | ||. ||| |.||||||  .| |     |    ||   .
Sbjct: 1386555 EECIVQDLVIIVYGVGEFTSLSVMAVDRYIAICRPLHYHSIMSPFTVLCLLFFIWVFSSS 1386376

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNEL---TLMITSSIFVLIPL 214
                  .  | |   |.| |  ..  |||  .|..|.|       .    | |. |.     |
Sbjct: 1386375 VGLMAISLTLKYPICRH-DINKLFCEHLSLMKLACKQDFFQGIFNGFLYISMSVL----L 1386211

Query:     215 ILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMA---VSLFFIPAMCIYLQPPSGNSQ 271
               . .| ||  |. |    .|    .| . ||  ||.     |     ..| .    .  |.
Sbjct: 1386210 VFVLFSYLKIILAC--RKSKVCREKFYSTCMPHLITFLNTSCGISDSLCTHFNVET-LSR 1386040

Query:     272 DQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                   |...    . | .||||| ..   .|  .
Sbjct: 1386039 IVYTFLSIINLTLPPFVNPLIYGIKLGPIRAKI 1385941

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  119 bits (297), Expect = 1e-025
 Identities = 79/271 (29%), Positives = 131/271 (48%), Gaps = 13/271 (4%)
 Frame = +2

Query:     38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
              |   .. |. |..  .|.  || |||  .| ||   |  |    |..| .|     .|| 
Sbjct: 991589 YFAIILFNVLIMLAVFLERTLHQPMYILISCLSMNSLFGTAGFFPRVLSDLLSETHSISR 991768

Query:     98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                |  | . .      |  .|..|..||.||.|.|| |  .. |||   | | .      
Sbjct: 991769 EACFFQCFVIFTYAANEFSILMLMAFDRFAAICKPLRYHSIVRPRFLACLIVTNLTIPMI 991948

Query:    158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                |. |  |  . .||.. .   .|    ...||| .  .|    .    |  .||| ||
Sbjct: 991949 LLAVGSLLTTKLRMCGNK-LTKVYCHTYEVVKLSCDNIAINNAFGLFILIITTIIPLGLI 992125

Query:    218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMC-------IYLQPPSGNS 270
                ||  |.  . .  |     | | ||  |.. .  | .   |         || | | |
Sbjct: 992126 SFSYVKIL-IICQRSSAQFKGKAFQTCIPHIVVLLNFTMAVTCDVTLSRVANLQIPVGLS 992302

Query:    271 QDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
                   |..| . .. | ||||||      .|
Sbjct: 992303 ----VFLSLEFLIIPPILNPLIYAFNLPDIR 992383

>Zv7_masked||Zv7_scaffold2090 |chr21|Len:54498|start:35116111|end:35170608

          Length = 54498

 Score =  119 bits (297), Expect = 1e-025
 Identities = 68/274 (24%), Positives = 137/274 (50%), Gaps = 6/274 (2%)
 Frame = +1

Query:   38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLW--GPEKTI 95
            |. |.  |. . ||     .|| ||.|   |.   |.  .|  .|.||  .     .. .
Sbjct: 3835 YVFTMGCNIGLTILILTQKNLHNPMHFLFCNMPVNDIIGSTVIMPRLLQGILREASQRYM 4014

Query:   96 SYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSG 155
            .|  |..| .||    .    .|..|..||| |.|.|| |  .|  .    |.  .|   
Sbjct: 4015 TYTECVVQAFFVHVFASVSHSVLIIMAFDRYVAICKPLRYAAIMSNKMVVRLSALAWGVS 4194

Query:  156 FTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVD-THVNELTLMITSSIFVLIPL 214
                 .  . .  .  |    ... ||.  .| .||| .   .| |  . .. .     |
Sbjct: 4195 VIAVTVMIALSLRLSRC-RSYIENPFCDNASLFKLSCEEGVVINNLFGIFSTVVMFTFSL 4371

Query:  215 ILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIP-AMCIYLQPPSGNSQDQ 273
              .  .|| |  .    .  .   |   ||| |.    . |.  |. |.|     .|...
Sbjct: 4372 GSVFVTYGKIAASFRNRKHNSFNSKAMKTCGTHIALYLIMFVSCAIMIFLHRSPQHSENR 4551

Query:  274 GKFIALFYTVVTPSLNPLIYTLRNKVVRGAVKRL 307
             |  .. . .  | ||||.| |. | .|    .|
Sbjct: 4552 -KLASIMFHIAPPGLNPLVYGLQTKEIRQNTSKL 4650

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  119 bits (296), Expect = 2e-025
 Identities = 80/291 (27%), Positives = 140/291 (48%), Gaps = 5/291 (1%)
 Frame = +2

Query:      14 YFILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLD 73
               ||  . | |  .            | . .. |  |||  . .  || |||  .| ||   
Sbjct: 1008914 YFYFMFFENLGYIRYALFTSGLILYCVIILFNAVIIITIFWNRTLHQPMYILISCLSVNS 1009093

Query:      74 LCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPL 133
               .  |    |..|..|     .||   | .| . .    | |  .|..|. ||. |. .||
Sbjct: 1009094 VYGTAGFFPRVLIDLLSDTHSISREACFLQSFVIYTYITNENTILMLMALDRFVAISKPL 1009273

Query:     134 HYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCV 193
                |  ..  ||  .| ...|        . . ||  . |||.. .   ||    . .||||
Sbjct: 1009274 QYHNIITKRFLTVLYLSNWAYSVLCIGIAAIFTAGLKLCGNK-LWKVFCHNYEIAKLSCV 1009450

Query:     194 DTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSL 253
               .. .  .  .   .  |.||| ||. ||  |.  . |  |    .| | ||  |.. .  
Sbjct: 1009451 NSLIVNIIGLYVLATTVIIPLSLIIYSYVKIL-IICRRSSPQFKKKSFQTCVPHIVVLLN 1009627

Query:     254 FFIPAMCIYLQPPSGN---SQDQGKFIALFYTVVTPSLNPLIYTLRNKVVR 301
               | .  .         |   |     ||.| . .. | ||||.| |    .|
Sbjct: 1009628 FSVSVISEITLSRVVNLNISVGLSVFISLEFLLIPPILNPLVYGLSLSDIR 1009780

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  117 bits (292), Expect = 5e-025
 Identities = 89/308 (28%), Positives = 137/308 (44%), Gaps = 12/308 (3%)
 Frame = -3

Query:       4 DGKVNASSEGYFILVGFSNWPHXXXXXXXXXXX-XYLMTLIGNLFIIILSYLDSHLHTPM 62
               .|  | |.     .   ..|               ||.|.. |  .|..   .  || ||
Sbjct: 1375926 EGMENISTSHILTVTALNDWDWTSRILFFSFALPGYLLTIVMNATLILIIAFEKALHEPM 1375747

Query:      63 YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMS 122
               | || ||   |||  |   |. || |      ||   |..|   ..     |   | ||.
Sbjct: 1375746 YIFLCNLCVNDLCGITGFYPKALVYLLTETNRISLE*CIVQGLVIVIYAVGEFSNLSVMA 1375567

Query:     123 YDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFC 182
                ||| |.||||||  .| |     |   .||  |  | .        |.| .  .|  ||
Sbjct: 1375566 IDRYLAICRPLHYHSIMSPFTVLCLLSFNWVFPFIASLVAIVVAMKNPICKY-DIDKLFC 1375390

Query:     183 EVPALLRLSC-VDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVF 241
               |  .|. | |  |         .  |. .||  .||  ||  |. |    .|    .| .
Sbjct: 1375389 ENLSLVNLGCKPDISYGIFNGWMYGSVIILIGFVLI--SYFKIILAC--RKSKVSREKFY 1375222

Query:     242 GTCGAHLMAVSLFFIPAMCIYLQPPSG-NSQDQGKFIALFYTVV----TPSLNPLIYTLR 296
                ||  ||.    .   .     |   |  ||    |. .| .|.     | .||.|| ..
Sbjct: 1375221 STCMPHLIIFLNYIGCSFFDSSQTE*GAKSQYVSHFVHMFLSVIFLTLPPVVNPVIYGIK 1375042

Query:     297 NKVVRGAV 304
                  .|  .
Sbjct: 1375041 LSPIRAKI 1375018

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  114 bits (285), Expect = 3e-024
 Identities = 77/270 (28%), Positives = 134/270 (49%), Gaps = 7/270 (2%)
 Frame = -2

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||. |  |. ....  ..  || ||| || .|    .   |   |. | .|      || 
Sbjct: 1458307 YLLILSINIRLVMVIIMEKALHGPMYIFLCHLCVNGVYGATGFYPKFLSDLILDSYVISS 1458128

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                 | .| | . .   ..  .| ||||||| |.|.||.|   .    | .| . ||.    
Sbjct: 1458127 HMCALQTYVIYSSLLSDITILTVMSYDRYVAICKPLNYHSKLTKLTCAILILLSWIVPNF 1457948

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
               .           | | .  .| |.|.  ....|||  . || .   | . ||.   .|..
Sbjct: 1457947 SVIPAIMLAHLRPFCKY-HIDKFYCDNWSVVKLSCASSFVNNVYGYIVTVIFISCAVIIV 1457771

Query:     218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMA-VSLFFIPAMCIYLQPPSGNS--QDQG 274
               . ||  .. |    .|    .| . ||  || . ..| |     .       |   .   
Sbjct: 1457770 V-SYIKLIAAC--KESLENRKKFWQTCLPHLFSLMNLIFTLLFDVTYSRYGSNDIPESLR 1457600

Query:     275 KFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                |.||   .|.|  ||||| |  . .|  |
Sbjct: 1457599 SFLALELVIVSPVFNPLIYGLNVRAIRERV 1457510

>Zv7_masked||Zv7_scaffold2129 |chr21|Len:70142|start:45129009|end:45199150

          Length = 70142

 Score =  114 bits (283), Expect = 6e-024
 Identities = 77/270 (28%), Positives = 134/270 (49%), Gaps = 7/270 (2%)
 Frame = +1

Query:    38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
             ||. |  |. ....  ..  || ||| || .|    .   |   |. | .|      || 
Sbjct: 43459 YLLILSINIRLVMVIIMEKALHGPMYIFLCHLCVNGVYGATGFYPKFLSDLILDSYVISS 43638

Query:    98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
               | .| | . .   ..  .| ||||||| |.|.||.|   .    | .| . ||.    
Sbjct: 43639 HMCALQTYVIYSSLLSDITILTVMSYDRYVAICKPLNYHSKLTKLTCAILILLSWIVPNF 43818

Query:   158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
             .           | | .  .| |.|.  ....|||  . || .   | . ||.   .|..
Sbjct: 43819 SVIPAIMLANLRPFCKY-HIDKFYCDNWSVVKLSCASSFVNNVYGYIVTVIFISCAVIIV 43995

Query:   218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMA-VSLFFIPAMCIYLQPPSGNS--QDQG 274
             . ||  .. |    .|    .| . ||  || . ..| |     .       |   .   
Sbjct: 43996 V-SYIKLIAAC--KESLENRKKFWQTCLPHLFSLMNLIFTLLFDVTYSRYGSNDIPESLR 44166

Query:   275 KFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
              |.||   .|.|  ||||| |  . .|  |
Sbjct: 44167 SFLALELVIVSPVFNPLIYGLNVRAIRKRV 44256

>Zv7_masked||Zv7_scaffold1493 |chr15|Len:1734679|start:28189292|end:29923970

          Length = 1734679

 Score =  113 bits (281), Expect = 9e-024
 Identities = 75/268 (27%), Positives = 122/268 (45%), Gaps = 8/268 (2%)
 Frame = -2

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||  |. || |||   |. .|| |||  | ||   |.   |   |||| ..|  ...|||
Sbjct: 1401273 YLFILLCNLTIIITICLNRNLHKPMYILLLNLPINDVLGATCLFPQLLYSIWSQDRSISY 1401094

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
               . |..| .||   | |  ..|  |.||||  .| || |  .|       . .  |.    
Sbjct: 1401093 SACLLQGFFVHLNGGASYLILTAMAYDRYITICCPLRYGAIMTTNNLLRIIIGMWLFNVV 1400914

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                  .         .|     |   |    |..| |    || .  .     .  . | ..
Sbjct: 1400913 AITVICVLLLPYRICQTHMTD-LVCYKTPLMKLLCDGIEVNNIYGLCCIIFYHGLALSVV 1400737

Query:     218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFI 277
                 .|  |.   .  . .    |   ||| ||.   |  |  .   |   .  |.    |.
Sbjct: 1400736 AFTYIHILITCVTNKQSDARVKALQTCGTHLVVFLLLEINTLFPLL---AHRSEIIPAFL 1400566

Query:     278 ALFYT----VVTPSLNPLIYTLRNKVVR 301
                  ..    .  | .|||||  . | .|
Sbjct: 1400565 RRVFSISNFIFPPLVNPLIYGFKTKEIR 1400482

>Zv7_masked||Zv7_scaffold1470 |chr15|Len:1170721|start:4665410|end:5836130

          Length = 1170721

 Score =  110 bits (274), Expect = 6e-023
 Identities = 73/272 (26%), Positives = 127/272 (46%), Gaps = 6/272 (2%)
 Frame = -1

Query:     42 LIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVN-LWGPEKTISYAGC 100
              .. ||||| . | .  || ||| || .|    || . .  | .| | |      .    |
Sbjct: 920608 IVANLFIIGIIYKEKSLHEPMYVFLCSLCANQLCGSFALFPFVLGNMLRSKTPEVPLTVC 920429

Query:    101 MIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSA 160
                |.. . .    |   | .|||||| |.| || |  .| |     |    |       .
Sbjct: 920428 HAQIFALYSYAQVEFCNLAMMSYDRYVAICHPLEYHRIMSPARTMTLIALGWSLEIMILS 920249

Query:    161 LHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTS 220
                 |    .  ||.  .|  .|.   |..|.| ||  | .  .    . .  ||..|  |
Sbjct: 920248 FSFSVNVQLKFCGN-VLDKVWCDQYMLVKLACSDTTPNNIIGITGIPLAIGPPLLIIFFS 920072

Query:    221 YGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQG---KFI 277
              |  |..  |.       . .. ||  ||. .  | .      .|   |           .
Sbjct: 920071 YAKILRVCLKFTRQKAKKSLY-TCSLHLITLLNFTVGCSFELIQSRFGKLPIPAVVRVIL 919895

Query:    278 ALFYTVVTPSLNPLIYTLRNKVVRGAVKRLMG 309
              .|.. |  | .||..| .    .. |.|. .|
Sbjct: 919894 SLYFLVCPPLINPIMYGVSLTNIKKALKKCIG 919799

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  108 bits (269), Expect = 2e-022
 Identities = 76/270 (28%), Positives = 124/270 (45%), Gaps = 7/270 (2%)
 Frame = -3

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||. |  |. ....  ..  || ||| || .|    .   |   |..| .|      || 
Sbjct: 1404840 YLLILSINICLVMVIIIEKVLHEPMYIFLCHLCINGVYGATGFYPKILSDLILDSYVISS 1404661

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                 | .| | . .   .|  .| ||||||| |.|.|| |   .    |  | . ||.   .
Sbjct: 1404660 HMCALQTYVIYSSLLSEITILTVMSYDRYVAICKPLDYHSRLTKNTCVKLILFSWIVPTS 1404481

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
                |      .     | .  .|  .|.  ....|||| . || .     . ||    ..||
Sbjct: 1404480 FSVASILLSNLRAFCKY-HIDKLYCDNWSIVKLSCVSSFVNNVFGYGIAVIFFSF-VVLI 1404307

Query:     218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNS---QDQG 274
               . ||  .| |     |    .| . ||  |                    |.    .   
Sbjct: 1404306 IFSYIKLVAAC--KASLENRKKFWQTCLPH................YNRYGSKDIPESLR 1404133

Query:     275 KFIALFYTVVTPSLNPLIYTLRNKVVRGAV 304
                |.||   .| |  |||.| |  . ||  |
Sbjct: 1404132 HFLALELVIVPPLFNPLMYGLNIRAVRKRV 1404043

>Zv7_masked||Zv7_scaffold1021 |chr10|Len:776822|start:33632259|end:34409080

          Length = 776822

 Score =  105 bits (261), Expect = 2e-021
 Identities = 66/255 (25%), Positives = 125/255 (49%), Gaps = 15/255 (5%)
 Frame = +3

Query:     15 FILVGFSNWPHXXXXXXXXXXXXYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDL 74
              ||. || .  .            |.  ||||.  . .   | ||| |||  . ||. .|.
Sbjct: 173898 FIITGFDHLQN-QKLLGSLILISYMFILIGNIINLCIISTDRHLHKPMYILICNLAVVDI 174074

Query:     75 CYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLH 134
               |...    ..  |    | .||  |. . .|      |||. | .|. ||  |.  || 
Sbjct: 174075 MYSSTCSTTMISVLLAEIKMVSYYSCITRTFFYHVADIAECMALTLMAIDRVVAIRLPLR 174254

Query:    135 Y-TVLMHPR-FCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSC 192
              | ... . | || .    .|. ||      .|     | |    . . ||   .|.| .|
Sbjct: 174255 YHSIVTNLRTFCFIF--VTWLMGFAAVGFFTSVLDKSPYC-QPLIKYAFCSYSSLVRAAC 174425

Query:    193 VDTHVNELTLMITSSIFVLIPLI----LILTSYGAIVQAVLRMQSTTGLQKVFGTCGAHL 248
              ||         . |.|. ..||      .. .|  .  .| .. | .  ...  || .||
Sbjct: 174426 VDPE----PYFVISTIYSMVPLCGLFPFVMCTYAFLAYSVTKL-SNSSRKQMINTCLSHL 174590

Query:    249 MAVSLFFIPAMCIYL 263
              . .  .. | .   |
Sbjct: 174591 IVLLSYYAPKVVTIL 174635

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  105 bits (261), Expect = 2e-021
 Identities = 73/267 (27%), Positives = 130/267 (48%), Gaps = 7/267 (2%)
 Frame = -2

Query:      38 YLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISY 97
               ||. |  |. ....  ..  || ||| || .|    .   |   |..| .|      || 
Sbjct: 1411399 YLLILSINIRLVVVIVMEKVLHEPMYIFLCHLCINGVYGATGFYPKILSDLILDSYVISS 1411220

Query:      98 AGCMIQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFT 157
                 | .|.. . .    |  .| ||||||| |.|.|| |   .    |  | . | ..   
Sbjct: 1411219 HMCALQIFVIYSSLLCEFTILTVMSYDRYVAICKPLDYHTRLTKNTCVKLILFSRIAPTF 1411040

Query:     158 NSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILI 217
               .  . .  .   | | .  .|  .|.  ....|||  . ||..   |   . .    . |
Sbjct: 1411039 SVFIGTLLSNVRPFCTY-HIDKLYCDNWSVVKLSCASSFVNDVYGYIIGVVSISF-AVFI 1410866

Query:     218 LTSYGAIVQAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNS---QDQG 274
               . ||  .| |     |    .| . ||  |. ..  | |     ..    |     .   
Sbjct: 1410865 IFSYIKLVAAC--KASLENRKKFWQTCLPHIFSLINFCIAITFDFMYSRYGAKDVPESLR 1410692

Query:     275 KFIALFYTVVTPSLNPLIYTLRNKVVR 301
                |.||   .| |  ||||| |  .|.|
Sbjct: 1410691 HFLALELVIVPPLFNPLIYGLNIRVLR 1410611

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  91 bits (224), Expect = 4e-017
 Identities = 59/180 (32%), Positives = 88/180 (48%), Gaps = 4/180 (2%)
 Frame = -1

Query:      42 LIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCM 101
               .| .| |.|... .  || ||| || .|   |||       . |  |      ||.  |.
Sbjct: 1377593 MIWHLLIMIIAF-EKTLHEPMYIFLCHLCVNDLCGIVGFYLRALTYLLTERNVISHEKCI 1377417

Query:     102 IQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSAL 161
               .|   ..  |  |   | ||. ||| |.||||||  .| |     |    ||       .
Sbjct: 1377416 VQDLVIIVYGVGEFTSLSVMAVDRYIAICRPLHYHSIMSPFTVLSLVTFIWVFSCFVGLM 1377237

Query:     162 HSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSY 221
                 | |   |.| |  ..  |||  .|..|.|           .  |. ||  |. .| ||
Sbjct: 1377236 AISLTLKYPICRH-DINKPFCEHLSLMKLACNKLFKGIFNGFLYISMSVL--LVFVLFSY 1377066

>Zv7_masked||Zv7_scaffold2052 |chr21|Len:6713612|start:9191440|end:15905051

          Length = 6713612

 Score =  80 bits (196), Expect = 7e-014
 Identities = 55/184 (29%), Positives = 90/184 (48%), Gaps = 4/184 (2%)
 Frame = -3

Query:      68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
               ||    .   |   |. | .|      ||   | .| | .     ..  .| ||||||| 
Sbjct: 1463970 NLCITGVYGATGFYPKFLSDLILDSYVISSHMCALQTYVIYNSLLSDITILTVMSYDRYV 1463791

Query:     128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
               |.|.||.|   .    | .| . ||.    .           | | .  .| |.|.  ..
Sbjct: 1463790 AICKPLNYHSKLTKLTCAILILLSWIVPNFSVIPAIMLANLRPFCKY-HIDKFYCDNWSI 1463614

Query:     188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
               ..|||  . || .     | ||.   ||.|. ||  .| |  .  |    .||. ||  |
Sbjct: 1463613 VKLSCASSFVNNVYSYNFSIIFISCALIIIV-SYIKLVAACTK--SLENRKKVWQTCLPH 1463443

Query:     248 LMAV 251
               | ..
Sbjct: 1463442 LFSL 1463431

>Zv7_masked||Zv7_scaffold2129 |chr21|Len:70142|start:45129009|end:45199150

          Length = 70142

 Score =  74 bits (181), Expect = 4e-012
 Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 7/184 (3%)
 Frame = +3

Query:    68 NLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTAECVLLVVMSYDRYA 127
             ||    .   |   |. | .|      ||   | .| | . .   ..  .| ||||||| 
Sbjct: 37776 NLCITGVYGATGFYPKFLSDLILDSYVISSHMCALQTYVIYSSLLSDITILTVMSYDRYV 37955

Query:   128 AVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPAL 187
             |.|.||.|   .    | .| . ||.    .           | | .  .| |.    ..
Sbjct: 37956 AICKPLNYHSKLTKLTCAILILLSWIVPNFSVIPAIMLAHLRPFCKY-HIDKFYW---SI 38123

Query:   188 LRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVQAVLRMQSTTGLQKVFGTCGAH 247
             ..|||  . || .     | ||.   ||.|. ||  .| |  .  |    .||. ||  |
Sbjct: 38124 VKLSCASSFVNNVYSYNFSIIFISCALIIIV-SYIKLVAACTK--SLENRKKVWQTCLPH 38294

Query:   248 LMAV 251
             | ..
Sbjct: 38295 LFSL 38306

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0