BLASTP 7.6.0


Query=uc003qyg
       |6_cox_hap1|NM_006510|P14373|TRI27_HUMAN|TRIM27|NM_006510|NP_006501|ret
       finger protein
        (513 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    171   8e-041
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    169   2e-040
Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|en...    169   3e-040
Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    168   4e-040
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    167   1e-039
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    164   6e-039
Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    164   1e-038
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    163   2e-038
Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    161   8e-038
Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:...    157   1e-036
Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|en...    155   3e-036
Zv7_masked||Zv7_scaffold1025 |chr10|Len:919371|start:36202715|en...    151   6e-035
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...    151   6e-035
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    146   2e-033
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    145   5e-033
Zv7_masked||Zv7_scaffold291 |chr3|Len:812120|start:57170238|end:...    144   1e-032
Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end...    144   1e-032
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    143   1e-032
Zv7_masked||Zv7_scaffold703 |chr7|Len:3579684|start:19190852|end...    143   1e-032
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    142   4e-032
Zv7_masked||Zv7_scaffold1903 |chr19|Len:162695|start:33544340|en...    141   5e-032
Zv7_masked||Zv7_scaffold78 |chr1|Len:1166935|start:54488721|end:...    141   7e-032
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...    136   3e-030
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...    134   1e-029
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    132   2e-029
Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|en...    132   3e-029
Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end...    131   5e-029
Zv7_masked||Zv7_scaffold1104 |chr11|Len:1101006|start:38750778|e...    131   9e-029
Zv7_masked||Zv7_scaffold1104 |chr11|Len:1101006|start:38750778|e...    130   2e-028
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...    129   3e-028
Zv7_masked||Zv7_scaffold446 |chr5|Len:3556776|start:11238757|end...    128   5e-028
Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:...    128   5e-028
Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:...    127   1e-027
Zv7_masked||Zv7_NA211 |chrNA|Len:47979                                 126   2e-027
Zv7_masked||Zv7_scaffold1164 |chr12|Len:2996289|start:19901072|e...    124   6e-027
Zv7_masked||Zv7_scaffold1903 |chr19|Len:162695|start:33544340|en...    124   6e-027
Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3...    122   2e-026
Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|e...    121   9e-026
Zv7_masked||Zv7_scaffold1572 |chr16|Len:1454232|start:5719242|en...    109   2e-022
Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3...    109   3e-022
Zv7_masked||Zv7_scaffold231 |chr3|Len:3782459|start:4839510|end:...    109   3e-022
Zv7_masked||Zv7_scaffold223 |chr3|Len:324853|start:1993889|end:2...    109   4e-022
Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3...    109   4e-022
Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:...    107   1e-021
Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3...    106   2e-021
Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:...    106   3e-021
Zv7_masked||Zv7_scaffold1365 |chr14|Len:2230408|start:9926351|en...    104   1e-020
Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|en...    103   2e-020
Zv7_masked||Zv7_scaffold1850 |chr18|Len:1012904|start:45901656|e...    103   2e-020
Zv7_masked||Zv7_scaffold2122 |chr21|Len:25789|start:44468724|end...    101   6e-020
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...    101   8e-020
Zv7_masked||Zv7_scaffold236 |chr3|Len:3593183|start:14632275|end...    101   8e-020
Zv7_masked||Zv7_scaffold1005 |chr10|Len:2653080|start:19235089|e...    101   1e-019
Zv7_masked||Zv7_scaffold1787 |chr18|Len:760096|start:5272124|end...     99   2e-019
Zv7_masked||Zv7_scaffold331 |chr4|Len:771400|start:828519|end:15...     99   3e-019
Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end...     98   5e-019
Zv7_masked||Zv7_scaffold280 |chr3|Len:181614|start:51916320|end:...     97   1e-018
Zv7_masked||Zv7_scaffold221 |chr3|Len:298820|start:1455821|end:1...     95   6e-018
Zv7_masked||Zv7_scaffold2205 |chr22|Len:247203|start:34696840|en...     92   5e-017
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     90   1e-016
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     90   2e-016
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     89   2e-016
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     89   4e-016
Zv7_masked||Zv7_scaffold2218 |chr22|Len:302853|start:38520126|en...     88   5e-016
Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:...     88   7e-016
Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|e...     87   1e-015
Zv7_masked||Zv7_scaffold2205 |chr22|Len:247203|start:34696840|en...     87   1e-015
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     86   2e-015
Zv7_masked||Zv7_scaffold223 |chr3|Len:324853|start:1993889|end:2...     86   3e-015
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     86   3e-015
Zv7_masked||Zv7_scaffold2240 |chr23|Len:1049797|start:4511522|en...     86   3e-015
Zv7_masked||Zv7_scaffold2218 |chr22|Len:302853|start:38520126|en...     85   6e-015
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     85   6e-015
Zv7_masked||Zv7_scaffold2205 |chr22|Len:247203|start:34696840|en...     84   1e-014
Zv7_masked||Zv7_scaffold160 |chr2|Len:160001|start:44916556|end:...     84   1e-014
Zv7_masked||Zv7_scaffold311 |chr3|Len:276465|start:61512878|end:...     83   2e-014
Zv7_masked||Zv7_scaffold2208 |chr22|Len:182503|start:35331637|en...     83   2e-014
Zv7_masked||Zv7_scaffold2218 |chr22|Len:302853|start:38520126|en...     83   2e-014
Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|e...     82   3e-014
Zv7_masked||Zv7_scaffold284 |chr3|Len:334356|start:53561975|end:...     82   3e-014
Zv7_masked||Zv7_scaffold138 |chr2|Len:2223622|start:34119787|end...     81   6e-014
Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|e...     81   6e-014
Zv7_masked||Zv7_scaffold311 |chr3|Len:276465|start:61512878|end:...     81   6e-014
Zv7_masked||Zv7_scaffold2208 |chr22|Len:182503|start:35331637|en...     80   1e-013
Zv7_masked||Zv7_scaffold1025 |chr10|Len:919371|start:36202715|en...     80   1e-013
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     80   1e-013
Zv7_masked||Zv7_scaffold2218 |chr22|Len:302853|start:38520126|en...     80   2e-013
Zv7_masked||Zv7_scaffold1261 |chr13|Len:769061|start:11625969|en...     78   7e-013
Zv7_masked||Zv7_scaffold281 |chr3|Len:410676|start:52098034|end:...     77   2e-012
Zv7_masked||Zv7_scaffold223 |chr3|Len:324853|start:1993889|end:2...     75   3e-012
Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end...     75   6e-012
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     71   9e-011
Zv7_masked||Zv7_scaffold2428 |chr25|Len:2904654|start:7858903|en...     71   9e-011
Zv7_masked||Zv7_scaffold902 |chr9|Len:646172|start:3746856|end:4...     69   2e-010
Zv7_masked||Zv7_scaffold451 |chr5|Len:3929607|start:20283276|end...     69   3e-010
Zv7_masked||Zv7_NA121 |chrNA|Len:237060                                 68   7e-010
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     68   7e-010
Zv7_masked||Zv7_scaffold1365 |chr14|Len:2230408|start:9926351|en...     67   9e-010
Zv7_masked||Zv7_scaffold1502 |chr15|Len:1652584|start:36734931|e...     67   1e-009
Zv7_masked||Zv7_scaffold2286 |chr23|Len:202071|start:41683726|en...     67   2e-009

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  171 bits (431), Expect = 8e-041
 Identities = 86/178 (48%), Positives = 114/178 (64%)
 Frame = -3

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              ||..|.|||||.| |.|||. .|||   .. .||| ||||.  | ||    | ||| |.|
Sbjct: 447126 SVELTMDPDTAHPELLLSDDRKQVRVQDVEHELPDIPERFDYCPDVLAKEGFSAGRFYFE 446947

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              |.|  |  | .||  .|. ||| .|  |||||||| |    || | | |  .| ||   |
Sbjct: 446946 VQVKGKTDWVVGVARESINRKGEITVNPQNGFWAVGLRNESEYKACTGPAVSLSLRVKPQ 446767

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIICPM 492
              .||.|.||. | ||||.|  | | ..|   .|   | |.||     |    |||| |.
Sbjct: 446766 KVGVFVDYEEGLVSFYDVESRSHIYSFIGQSFTEKVYPFFSPEVIEGGQNPPLIISPV 446593

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  169 bits (428), Expect = 2e-040
 Identities = 87/182 (47%), Positives = 120/182 (65%), Gaps = 1/182 (0%)
 Frame = +3

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              ..||||||||||| | |||||. .|||   ..|.||| |.||. .  |||   | .|| |
Sbjct: 124719 VFSVDVTLDPDTANPYLILSDDGKQVRCGDIEQELPDKPQRFDKYEDVLGKEGFSSGRFY 124898

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
              .||.|  |  ||.||  .|| ||| .| .| ||.| | |  | ||        .| |.  
Sbjct: 124899 YEVQVKKKTDWTLGVVRESVDRKGEITLSPGNGYWTVWLRNGNEYKFCADSPVSLSLKVK 125078

Query:    433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICP 491
               ||||.|.||. | ||||.|    | ....  ||   . ||||      ||..||||| |
Sbjct: 125079 PQRVGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEDNDDGKNSAPLIITP 125258

Query:    492 MS 493
              ..
Sbjct: 125259 VN 125264

>Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|end:45582455

          Length = 159641

 Score =  169 bits (426), Expect = 3e-040
 Identities = 84/179 (46%), Positives = 121/179 (67%), Gaps = 1/179 (0%)
 Frame = -3

Query:   315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
             ||||||| ||| | |||||. .||   ......|.||||||    |||   | .|. |.|
Sbjct: 17076 SVDVTLDHDTANPFLILSDDEKQVSLGHIERNVPENPERFNHTVSVLGKQGFSSGKFYYE 16897

Query:   375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
             |.|  |  ||.|.  .|. ||| .| .|. ||| | |  | .| || ||  .| | |  .
Sbjct: 16896 VQVKGKTDWTVGLARESINRKGQITPSPEKGFWTVWLRNGNQYEALDSPAVSLSLSTSPE 16717

Query:   435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLIICPM 492
             .||.|.||. | ||||.| .  | ..|.  ||   . ||||   .  ||.. |||| |.
Sbjct: 16716 KVGVFVDYEKGLVSFYDVNDGSHIYSFTAQTFTETLYPYFSPGLNDDGKNSKPLIITPV 16540

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  168 bits (425), Expect = 4e-040
 Identities = 86/185 (46%), Positives = 122/185 (65%), Gaps = 1/185 (0%)
 Frame = -2

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              |.||||||||||| | |||.|. .|| .    |.||.||.|..    |||   | . | |
Sbjct: 468568 LFSVDVTLDPDTANPFLILTDDGKQVTHGDTNQNLPNNPQRYDQCNTVLGKEGFSSKRFY 468389

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
              .||.| .| || .||  .|| ||| .| .||.|.||| |     |||  .|   | .|  
Sbjct: 468388 FEVQVKEKTKWDLGVASESVKRKGKITLSPQHGYWAVGLRNSDVYWAFDAPAVRLSVREK 468209

Query:    433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG-GKSAAPLIICP 491
               |.||.|.||| | ||||.|  | | ..|.  .|   . | ||   .  ||..|||||  
Sbjct: 468208 PQKVGVFVDYDDGLVSFYDVESRSHIYSFTGQSFTEKLYPLFSPCINDEGKNSAPLIISA 468029

Query:    492 MSGID 496
              .  |.
Sbjct: 468028 VKSIE 468014

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  167 bits (421), Expect = 1e-039
 Identities = 83/177 (46%), Positives = 117/177 (66%), Gaps = 1/177 (0%)
 Frame = -1

Query:     314 YSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYW 373
               . ||.|.||.||.|.|||||. .||    .. .||||||||.   |||    | .|| |.
Sbjct: 2798201 FLVDITMDPETAHPNLILSDDGKQVTNGDIKLELPDNPERFSTCCCVLAKEGFNSGRFYF 2798022

Query:     374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPL 433
               ||.|  |  | .||   |  ||| .| ||..|.|||.   | .|    ||  .| ||   
Sbjct: 2798021 EVQVKQKTDWDLGVVRGSANRKGKITEAPEDGYWAVAFRKGNQYQVFKSPTVSLSLRVKP 2797842

Query:     434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLII 489
               | ||.|.||. | ||||.|   || ..|.  ||   . ||||   .  ||.|||.||
Sbjct: 2797841 QVVGVFVDYEEGLVSFYDVESGCHIYSFTGQTFTEKLFPYFSPGNAHKGKNAAPMII 2797671

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  164 bits (415), Expect = 6e-039
 Identities = 85/182 (46%), Positives = 119/182 (65%), Gaps = 1/182 (0%)
 Frame = +3

Query:   313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
             ..||||||||||| | ||||.. .||    ..| ||| |.||...  |||   | .|| |
Sbjct: 68976 VFSVDVTLDPDTANPYLILSEDGKQVTCGDIRQKLPDKPQRFDIYLDVLGKEGFSSGRFY 69155

Query:   373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
             .||.|  |  ||.||  .|| ||| |  .| .||| | |  | || |      .| ..  
Sbjct: 69156 YEVQVKGKTDWTLGVVRESVDRKGEVIHSPSDGFWTVILGDGNEYEANADSPVSLSVKVK 69335

Query:   433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLIICP 491
             |||||.|.||. | ||||.|    | ....  ||   . ||||   .  ||..  ||| |
Sbjct: 69336 LQRVGVFVDYEEGLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEINDNGKNSTSLIITP 69515

Query:   492 MS 493
             .|
Sbjct: 69516 VS 69521

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  164 bits (413), Expect = 1e-038
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 3/178 (1%)
 Frame = -3

Query:    316 VDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEV 375
              |||||| ||||| |||||. ...    . ||||| ||||.  | |||   |  || |.||
Sbjct: 460344 VDVTLDRDTAYPELILSDDGKEMIQGDVYQDLPDIPERFDHCPSVLGREGFSTGRFYFEV 460165

Query:    376 EVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQR 435
              .|  | .| .||  .|. ||| .  .||.| | |.|  | .|||   |  |. |    |.
Sbjct: 460164 KVKGKTEWILGVVRESINRKGKIKLSPQDGHWCVALMKGDQYWACADP--AVSLNVKPQK 459991

Query:    436 VGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSY-SGGKSAAPLIICPM 492
              ||.|.||. | | |..|  | | |.|.  .|   | |||   . | || . |||| |.
Sbjct: 459990 VGVFVDYEDGLVCFFDVVSRSHIFSFTRQSFINRVYPYFCACFTSNGKHSVPLIISPV 459817

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  163 bits (411), Expect = 2e-038
 Identities = 82/176 (46%), Positives = 116/176 (65%), Gaps = 1/176 (0%)
 Frame = -3

Query:     315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
               |||||||||||.| ||.||| .||    .. .| ||| ||.  ||||    | .|  |.|
Sbjct: 2786184 SVDVTLDPDTAHPDLIISDNEKQVTDGDIELELLDNPGRFDTCPCVLAKEGFNSGIFYFE 2786005

Query:     375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
               |.| .|  | .||  .|. ||| .|.||. |.| . |  | .| |. |   .| ||   |
Sbjct: 2786004 VQVKEKTDWNLGVVRESIKRKGDITAAPEEGYWIIVLGNGNQYLAIDSSSVSLSLRVKPQ 2785825

Query:     435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLII 489
                ||.|.||. | ||||.|    | ..|.  ||   . |.||  .   ||.|||||.
Sbjct: 2785824 VVGVFVDYEEGLVSFYDVESGSHIYSFTGQTFTEKLFPFFSPCNNQKGKNAAPLIL 2785657

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  161 bits (405), Expect = 8e-038
 Identities = 85/184 (46%), Positives = 120/184 (65%), Gaps = 6/184 (3%)
 Frame = -3

Query:    314 YSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYW 373
              .|||||||||||.| ||||.. .||.   .  ..|.| |||. | ||||   | .|. |.
Sbjct: 438570 FSVDVTLDPDTAHPCLILSNDGKQVKDGEINPNIPNNAERFDEFVCVLGKEGFSSGKFYF 438391

Query:    374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPL 433
              ||||  | .| .|| . || ||| .  .||.||| |.|    .|||   |   | ||   
Sbjct: 438390 EVEVKGKTEWDLGVAKGSVNRKGRIIMSPQDGFWTVALRKKNKYWA--CPCVPLSLRLKP 438217

Query:    434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATF---CGPVRPYFS-LSYSGGKSAAPLII 489
              | ||.|.||. | ||||.|  | | ..|.  .       . |.||   |  || .|||||
Sbjct: 438216 QTVGVFVDYEEGLVSFYDVESRSHMYSFTGQSLFFQSEQLHPFFSPCLYEEGKYSAPLII 438037

Query:    490 CPMS 493
               |..
Sbjct: 438036 SPVN 438025

>Zv7_masked||Zv7_scaffold694 |chr7|Len:1279595|start:8452820|end:9732414

          Length = 1279595

 Score =  157 bits (395), Expect = 1e-036
 Identities = 76/161 (47%), Positives = 107/161 (66%)
 Frame = -3

Query:    314 YSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYW 373
              .|||||||||||.  |||||. .||     .| .|.| |||.   ||||   |. || |.
Sbjct: 493755 FSVDVTLDPDTAHQKLILSDDGKQVSTEDTKQKVPNNLERFDKCICVLGKEGFLTGRLYF 493576

Query:    374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPL 433
              ||..  | .||.||  .|. ||| .|   |.|.||| |    ||||  .|   | .|   
Sbjct: 493575 EVQMKGKTEWTLGVARESINRKGKITVGLQDGYWAVGLRNENEYWAYAAPAVRLSVREKP 493396

Query:    434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYF 474
              |.||.|.||. | ||||.|  | | ..|.  .|   . |||
Sbjct: 493395 QKVGVFVDYEDGLVSFYDVESRSHIYSFTGQSFINRLYPYF 493273

>Zv7_masked||Zv7_scaffold2303 |chr23|Len:159641|start:45422815|end:45582455

          Length = 159641

 Score =  155 bits (391), Expect = 3e-036
 Identities = 79/179 (44%), Positives = 113/179 (63%), Gaps = 1/179 (0%)
 Frame = -3

Query:   315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
             ||||||||||| | |||||. .|| .  .. |.|. ||||.    |||   | .|. |.|
Sbjct: 27963 SVDVTLDPDTANPFLILSDDEKQVSHGDIEYDVPEIPERFDYTVSVLGKQGFNSGKFYYE 27784

Query:   375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
             |.|  | .| .||  .|. ||      | |||| ..|    ||     |. . | |   .
Sbjct: 27783 VQVKGKKEWDLGVARESISRKETNQLTPANGFWTMALINENEYLICDDPVVSFPQRAKPE 27604

Query:   435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLIICPM 492
             .||.|.||. | |||||| .  | ..|.  ||   . ||||   .  ||.. |||| |.
Sbjct: 27603 KVGVFVDYEEGLVSFYNVNDGSHIYSFTAQTFTETLYPYFSPCLNDDGKNSKPLIITPV 27427

>Zv7_masked||Zv7_scaffold1025 |chr10|Len:919371|start:36202715|end:37122085

          Length = 919371

 Score =  151 bits (380), Expect = 6e-035
 Identities = 75/161 (46%), Positives = 96/161 (59%), Gaps = 1/161 (0%)
 Frame = +1

Query:    318 VTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEV 377
              .| .  || | | |. .|  |||      . |||.|||    ..|   |  |||||||||
Sbjct: 703243 ITFNSKTANPWLSLTSSLTCVRYQTFNSSVQDNPQRFNAALSLMGGQGFTKGRHYWEVEV 703422

Query:    378 GDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVG 437
                   ||.||  .|| ||| . . | |||| .|| || .| | ||| | | |  || |.|
Sbjct: 703423 YSSTVWTVGVARESVTRKGVINTMPANGFWTLSLSYGVQYMAGTSPPTLLSLEEPLARIG 703602

Query:    438 IFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSY 478
              ..|||  | |||||     | .||   ||   . |||.| .
Sbjct: 703603 VYLDYKRGLVSFYNAESMTHLYTF-RDTFTETLFPYFNLGF 703722

>Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end:19142321

          Length = 6199740

 Score =  151 bits (380), Expect = 6e-035
 Identities = 78/176 (44%), Positives = 109/176 (61%), Gaps = 1/176 (0%)
 Frame = +3

Query:     315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
               .||| |||.|||| |.|| | .|| .     |.|.|||||.   ||||   |  || |.|
Sbjct: 3645144 AVDVILDPNTAYPKLVLSKNGKQVSHGGTWTDVPNNPERFDTSACVLGKDGFSCGRFYFE 3645323

Query:     375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
               |.| |||.| .|.   |. ||| .   |. |||..    | || |  |    | |.   |
Sbjct: 3645324 VQVSDKAEWDLGMARKSINRKGKIKVCPECGFWSIWKRNGNEYVANESSPVWLSLKDKPQ 3645503

Query:     435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLII 489
               .||.|.||| | ||||||      ..|.  .|   . |.||  .  |  .. ||||
Sbjct: 3645504 KVGVFVDYDEGLVSFYNVETEALIYSFTGQSFIEKIYPFFSPCNKRGNTNSKPLII 3645671

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  146 bits (368), Expect = 2e-033
 Identities = 74/182 (40%), Positives = 105/182 (57%), Gaps = 1/182 (0%)
 Frame = +2

Query:   313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
             ..||||                   |..  ..| ||. |.||. .  |||   | .|| |
Sbjct: 90824 VFSVDV...................VKHGDIRQKLPNKPQRFDRYAMVLGKEGFSSGRFY 91003

Query:   373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
             .||.|  | || .||  .|| ||| .|  | .||| | |  | .| |      .| |.  
Sbjct: 91004 FEVQVKGKTKWDLGVVRESVDRKGKITLRPSDGFWTVCLRNGNQYKAGADSPVSLSLKVK 91183

Query:   433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICP 491
             |||||.|.||. | ||||.|    | ..|.  ||   . ||||      ||..||||| |
Sbjct: 91184 LQRVGVFVDYEEGLVSFYDVESSSHIYSFTGQTFTDKLYPYFSPEDNDDGKNSAPLIITP 91363

Query:   492 MS 493
             .|
Sbjct: 91364 VS 91369

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  145 bits (364), Expect = 5e-033
 Identities = 74/153 (48%), Positives = 99/153 (64%), Gaps = 4/153 (2%)
 Frame = +3

Query:   343 LQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAP 402
             ..| ||| |.||.  |||||   | .|  |.||.|  |  ||.||  .|. ||| .|  |
Sbjct: 86553 IEQKLPDKPQRFDRCPCVLGKEGFSSGGFYFEVQVKGKTDWTLGVVRESINRKGEITLTP 86732

Query:   403 QNGFWAVSLWYGK-EYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTF 461
              |||| |  |  | || || ||   | |.  |||||.|.||. | ||||.|    | ...
Sbjct: 86733 SNGFWTV--WLRKNEYKALASPSVPLSLKVKLQRVGVFVDYEEGLVSFYDVESSSHIYSY 86906

Query:   462 SHATFCGPVRPYFSLSYS-GGKSAAPLIICPMS 493
             .  ||   . ||||   . |||.. |||| |.|
Sbjct: 86907 TGQTFTDKLYPYFSPGLNHGGKNSNPLIITPVS 87005

>Zv7_masked||Zv7_scaffold291 |chr3|Len:812120|start:57170238|end:57982357

          Length = 812120

 Score =  144 bits (361), Expect = 1e-032
 Identities = 78/177 (44%), Positives = 107/177 (60%), Gaps = 2/177 (1%)
 Frame = +2

Query:    314 YSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYW 373
              .|||| |.| ||.  | .|.. ..||..  ||..|.||.||.    |.    |  ||| |
Sbjct: 720983 FSVDVNLNPRTAHAYLYISEDRKEVRHANKQQEVPENPKRFDRVINVMSKEAFRYGRHLW 721162

Query:    374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPL 433
              ||.||||  | .|| . || |||  |  | |||| .||  | .| | | | |.  |    
Sbjct: 721163 EVDVGDKTDWDLGVAKQSVNRKGKFTICPSNGFWTLSLKNGSQYVANTYPPTSFNLSHKP 721342

Query:    434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSY-SGGKSAAPLII 489
              .|| |.|||| | ||||      | ..|   .|   . |  |     | |. |||||
Sbjct: 721343 KRVSIYLDYDEGRVSFYCSDTGTHIYSF-RDSFTDKLHPILSPGRPHGEKNTAPLII 721510

>Zv7_masked||Zv7_scaffold700 |chr7|Len:6199740|start:12942582|end:19142321

          Length = 6199740

 Score =  144 bits (361), Expect = 1e-032
 Identities = 77/182 (42%), Positives = 115/182 (63%), Gaps = 1/182 (0%)
 Frame = +3

Query:     316 VDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEV 375
               ||| ||||||.| ||||.. .||||  .. | | . .||  .  |||   | .|| |.||
Sbjct: 2257737 VDVILDPDTAHPKLILSEDGKQVRYGNIKHDRPGSDKRFENYIVVLGKEGFSSGRFYFEV 2257916

Query:     376 EVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQR 435
                |  | .| .||  .|. |||    .| .| |.. |    .  |  |   .| |.   | 
Sbjct: 2257917 NVSGKTEWLLGVARESLNRKGEFFLSPNDGNWSLWLKDENKCEACESLTLSLSLKVKPQT 2258096

Query:     436 VGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICPMSG 494
               ||.|.||. | ||||.|  | | ..|.  .|   . |. | || . |...||||| |..|
Sbjct: 2258097 VGVFVDYEEGLVSFYDVKSRSHIYSFTGQSFTEKLYPFLSPLSNNKGQNSAPLIISPVTG 2258276

Query:     495 ID 496
                |
Sbjct: 2258277 ND 2258282

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  143 bits (360), Expect = 1e-032
 Identities = 69/151 (45%), Positives = 97/151 (64%), Gaps = 1/151 (0%)
 Frame = +1

Query:   343 LQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAP 402
             ..| ||| |.||.  |||||   | .|| |.||.|  |  ||.||  .|. ||| .| .|
Sbjct: 92959 IRQKLPDTPQRFDRCPCVLGKEGFSSGRFYFEVQVKGKTDWTLGVVRESINRKGSITVSP 93138

Query:   403 QNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFS 462
              |||| | |  | || |   |  .| .   |||||.|.||. | || |.|    | ....
Sbjct: 93139 SNGFWTVVLRNGNEYKAFAGPSVSLSVGVNLQRVGVFVDYEEGLVSIYDVESSSHIYSYT 93318

Query:   463 HATFCGPVRPYFSLSY-SGGKSAAPLIICPM 492
               ||   . |.||    .|||.. |||| |.
Sbjct: 93319 GQTFTDKLYPFFSPHLNNGGKNSNPLIITPL 93411

>Zv7_masked||Zv7_scaffold703 |chr7|Len:3579684|start:19190852|end:22770535

          Length = 3579684

 Score =  143 bits (360), Expect = 1e-032
 Identities = 77/179 (43%), Positives = 107/179 (59%), Gaps = 2/179 (1%)
 Frame = -3

Query:     315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
               .|||||| .||.| ||||.| . |  |  || . .. |||.   ||||   |  ||||||
Sbjct: 2725267 TVDVTLDANTAHPRLILSENKKMVWCSENQQHVTNHRERFDRVVCVLGREGFNTGRHYWE 2725088

Query:     375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
               |.|  |  | .||   |  ||| .  .| .|.| .||     |   | | | | |    |
Sbjct: 2725087 VKVNGKTDWDLGVASHSCNRKGKIKVSPSHGYWFLSLRDKNNYAFRTEPPTVLHLSNKPQ 2724908

Query:     435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICPM 492
               ..|.|.||. |.||||.|  . |  ||    |   . |.||  .    |. |||.| |.
Sbjct: 2724907 KMGLFVDYEKGQVSFYDVDAKMHIHTFMD-NFSETIYPFFSPCTNKNSKNEAPLVITPV 2724734

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  142 bits (356), Expect = 4e-032
 Identities = 76/182 (41%), Positives = 101/182 (55%), Gaps = 4/182 (2%)
 Frame = +2

Query:   313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
             ..||||                  |||   . | |||  .||    ||||   | .|| |
Sbjct: 68534 VFSVDV..................QVRLGEIIQKLPDKSQRFEKCICVLGKEGFSSGRFY 68713

Query:   373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGK-EYWALTSPMTALPLRT 431
             .||.|  | || .||  .|| ||| .   | |||| |  |  | || || ||   | .. 
Sbjct: 68714 FEVQVKGKTKWDLGVARESVDRKGEIRLCPSNGFWTV--WLRKNEYKALASPSVPLSVKV 68887

Query:   432 PLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIIC 490
              |||||.|.||. | ||||.|    | ..|.  ||   . |.|.  |   | .. |||| 
Sbjct: 68888 KLQRVGVFVDYEEGLVSFYDVESSSHIYSFTGQTFTDKLYPFFNPCSNIDGNNSDPLIIT 69067

Query:   491 PM 492
             |.
Sbjct: 69068 PL 69073

>Zv7_masked||Zv7_scaffold1903 |chr19|Len:162695|start:33544340|end:33707034

          Length = 162695

 Score =  141 bits (355), Expect = 5e-032
 Identities = 75/181 (41%), Positives = 110/181 (60%), Gaps = 1/181 (0%)
 Frame = -1

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              ..|||||||||  .  | |||. .|||.  .  .    |.||.    |||   | .|| |
Sbjct: 135638 VFSVDVTLDPDKGHSDLKLSDDGKQVRFRDILPNYSSKPQRFDRNLFVLGREGFSSGRFY 135459

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
              .|| | .|  ||.||  .|  |   .| .|. | | |.|  | .| |   |  .| ||  
Sbjct: 135458 FEVLVKEKTDWTLGVARESTDRNKEITVSPRTGCWTVALINGNDYRACNDPPVSLSLRVT 135279

Query:    433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG-GKSAAPLIICP 491
               ||||.|.|.. | | || |   || ..|.  .|   . |.||   .  ||..||||| |
Sbjct: 135278 PQRVGVFVDHEEGLVCFYEVETSCHIYSFTGESFHDTLYPFFSPGPNPCGKNSAPLIITP 135099

Query:    492 M 492
              .
Sbjct: 135098 V 135096

>Zv7_masked||Zv7_scaffold78 |chr1|Len:1166935|start:54488721|end:55655655

          Length = 1166935

 Score =  141 bits (354), Expect = 7e-032
 Identities = 73/177 (41%), Positives = 109/177 (61%), Gaps = 2/177 (1%)
 Frame = +3

Query:     316 VDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEV 375
               |||||| |.|.| |..|.. .||  |   |..||  |||.   ||||     .| |||||
Sbjct: 1138482 VDVTLDKDSAHPRLVISEDGKQVLCSDRYQNVPDTLERFDRVVCVLGRQGINSGCHYWEV 1138661

Query:     376 EVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQR 435
                | ||  | .|.   .. ||| . . | |||| .||   ..|   | | | . .    ||
Sbjct: 1138662 LVSDKTDWDLGIAARTINRKGKIAANPANGFWFLSLRDKQDYVFRTEPSTPIIVNPKPQR 1138841

Query:     436 VGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICP 491
               . . .||. |..||||   .   ||..  .|   . |.||  .   ||. |||||||
Sbjct: 1138842 ITVSVDYERGQLSFYNADTKTLIFTYTD-SFSETLYPFFSPCTNKSGKNEAPLIICP 1139009

>Zv7_masked||Zv7_scaffold1867 |chr19|Len:328248|start:1325201|end:1653448

          Length = 328248

 Score =  136 bits (340), Expect = 3e-030
 Identities = 73/210 (34%), Positives = 100/210 (47%), Gaps = 1/210 (0%)
 Frame = +2

Query:    285 LFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQ 344
              || |  |   |  . |                                          . 
Sbjct: 106583 LFKTN*LNMHTILISSLQN.......................................II 106762

Query:    345 QDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQN 404
              | ||.||.||.    |||   | .|| |.||.|  | .| .||  .|| |||  |  | |
Sbjct: 106763 QKLPNNPQRFDYSVSVLGKEGFSSGRFYYEVQVKGKIEWELGVARESVGRKGTYTLNPSN 106942

Query:    405 GFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHA 464
              | | | |  | || | | |  .| |.   ||||.|.||. | | ||.     | |.|.  
Sbjct: 106943 GHWTVVLRNGNEYRACTGPSVSLSLKVKPQRVGVFVDYEEGLVCFYDAESGSHIFSFTGQ 107122

Query:    465 TFCGPVRPYFS-LSYSGGKSAAPLIICPMS 493
              ||   . |.|.   .  ||..||||| |..
Sbjct: 107123 TFTEKLYPFFNPCGHYAGKNSAPLIITPVN 107212

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  134 bits (335), Expect = 1e-029
 Identities = 75/171 (43%), Positives = 103/171 (60%), Gaps = 3/171 (1%)
 Frame = +2

Query:    323 DTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAK 382
              .|||| | || .|  |  .   | ||||||||.    ||||  | .| | ||||||    
Sbjct: 961991 NTAYPCLSLSKDLTSVSNTGTMQKLPDNPERFDHLVFVLGSKGFSSGCHSWEVEVGKNND 962170

Query:    383 WTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDY 442
              | ||| . || ||| ..  |. ||| ..|  | .| |.|.| | | | . |.|| . .||
Sbjct: 962171 WVIGVVKASVARKGKISGCPEGGFWTIALSDG-QYTAMTTPRTQLKLNSHLERVRVKIDY 962347

Query:    443 DAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLIICPM 492
              |||||||..  .    .||.   |   . |.|    .    .  || |||.
Sbjct: 962348 DAGEVSFFDSVDVAPLYTFTD-HFTEMMFPFFCPGANINRNNPGPLKICPV 962497

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  132 bits (332), Expect = 2e-029
 Identities = 66/151 (43%), Positives = 93/151 (61%), Gaps = 1/151 (0%)
 Frame = +2

Query:   343 LQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAP 402
             ..| ||| |.||.   ||||   | .|| |.||.|  |  | .||  .|. ||| .|.. 
Sbjct: 79022 IRQKLPDKPQRFDYCVCVLGKEGFSSGRFYFEVQVKGKTDWDLGVVRESINRKGQITASA 79201

Query:   403 QNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFS 462
               ||| | |  | || |  ||  .||..   ||||.|.||. | | ||.|    | ..|.
Sbjct: 79202 SKGFWTVVLRNGIEYKACASPPVSLPVKVKPQRVGVFVDYEEGLVLFYDVESSSHIYSFT 79381

Query:   463 HATFCGPVRPYFS-LSYSGGKSAAPLIICPM 492
               ||   . | ||      ||.. |||| |.
Sbjct: 79382 SQTFTDKLHPLFSPCPNCAGKNSNPLIITPV 79474

>Zv7_masked||Zv7_scaffold1472 |chr15|Len:3278087|start:6009756|end:9287842

          Length = 3278087

 Score =  132 bits (331), Expect = 3e-029
 Identities = 67/176 (38%), Positives = 98/176 (55%), Gaps = 1/176 (0%)
 Frame = -1

Query:     315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
               ||||                   | .   .  | .|||||.  ||||    | .|| |.|
Sbjct: 2820662 SVDV...................VTFGDKELKLLNNPERFDCCPCVLAKERFSSGRFYFE 2820483

Query:     375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
               |.| .|  | .||  .|. ||| .|.||. |.| . |    .| |. |   .| ||   |
Sbjct: 2820482 VQVKEKTDWDLGVVRESINRKGDITAAPEAGYWIIMLRNENQYLAIDSSSVSLSLRVKPQ 2820303

Query:     435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLII 489
                ||.|.||. | |.||.|      ..|.  ||   . ||||    .||.. |||||
Sbjct: 2820302 VVGVFVDYEEGLVTFYDVESGSFIYSFTGQTFSEKLSPYFSPYQNNGGRNTAPLII 2820135

>Zv7_masked||Zv7_scaffold1871 |chr19|Len:726802|start:1706372|end:2433173

          Length = 726802

 Score =  131 bits (329), Expect = 5e-029
 Identities = 69/182 (37%), Positives = 98/182 (53%), Gaps = 8/182 (4%)
 Frame = +3

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              ..|||                         ..|.||| |.||.  |||||   | .|| |
Sbjct: 104931 VFSVD.........................IRQELPDTPQRFDYCPCVLGKEGFSSGRFY 105110

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
              .||.|  |  | .||  .|. ||| .|  | |||  |  |  ||     .   .| |.  
Sbjct: 105111 YEVQVKGKTDWDLGVARESINRKGKITLTPGNGFCTV--WLRKE-----NECFSLSLKVK 105269

Query:    433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLIICP 491
               ||||.|.||. | ||||.|    | ..|.  ||   . ||||      ||.. |||| |
Sbjct: 105270 PQRVGVFVDYEEGLVSFYDVESSSHIYSFTDQTFTDKLYPYFSPCPNYEGKNSNPLIITP 105449

Query:    492 MS 493
              ..
Sbjct: 105450 VN 105455

>Zv7_masked||Zv7_scaffold1104 |chr11|Len:1101006|start:38750778|end:39851783

          Length = 1101006

 Score =  131 bits (327), Expect = 9e-029
 Identities = 71/175 (40%), Positives = 102/175 (58%), Gaps = 4/175 (2%)
 Frame = +1

Query:    318 VTLDPDTAYPSLILSDNLRQVRYSYLQ-QDLPDNPERFNLFPCVLGSPCFIAGRHYWEVE 376
              .|.|| ||.  |||||.   | |  |  | | |.| ||..   |||   |  | ||||| 
Sbjct: 625153 LTMDPSTAHQRLILSDDCTIVAYGNLHPQPLQDSPRRFDVEVSVLGDEGFSGGVHYWEVM 625332

Query:    377 VGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRV 436
              | .| .| |||  ..| ||| .   |  ||. . .  | .| | | | | | ... |..|
Sbjct: 625333 VSEKTQWMIGVANETVNRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVKSKLEKV 625512

Query:    437 GIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS--LSYSGGKSAAPLII 489
              |..|||  | . |||  .    .|.    |   . ||||   |.. ||.  || |
Sbjct: 625513 GVYLDYPKGLLVFYNADDMSWLYTY-REKFPAKLFPYFSPGQSHANGKNVQPLRI 625674

>Zv7_masked||Zv7_scaffold1104 |chr11|Len:1101006|start:38750778|end:39851783

          Length = 1101006

 Score =  130 bits (325), Expect = 2e-028
 Identities = 71/175 (40%), Positives = 102/175 (58%), Gaps = 4/175 (2%)
 Frame = +1

Query:    318 VTLDPDTAYPSLILSDNLRQVRYSYLQ-QDLPDNPERFNLFPCVLGSPCFIAGRHYWEVE 376
              .|.|| ||.  |||||.   | |  |  | | |.| ||..   |||   |  | ||||| 
Sbjct: 535363 LTMDPSTAHQRLILSDDCTIVAYGNLHPQPLQDSPRRFDVEVSVLGDEGFSGGVHYWEVM 535542

Query:    377 VGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRV 436
              | .| .| |||  ..| ||| .   |  ||. . .  | .| | | | | | ... |..|
Sbjct: 535543 VSEKTQWMIGVANETVNRKGSIQIQPGRGFYCIVMHDGNQYSACTEPWTRLNVKSKLEKV 535722

Query:    437 GIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS--LSYSGGKSAAPLII 489
              |..|||  | . |||  .    .|.    |   . ||||   |.. ||.  || |
Sbjct: 535723 GVYLDYPKGLLVFYNADDMSWLYTY-REKFPAKLFPYFSPGQSHANGKNVQPLRI 535884

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  129 bits (323), Expect = 3e-028
 Identities = 69/155 (44%), Positives = 96/155 (61%), Gaps = 2/155 (1%)
 Frame = -2

Query:    320 LDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGD 379
              |||..|.| | |||.|  . ||   | || |||||..   |||   | .  | ||.||||
Sbjct: 407788 LDPNSAHPCLTLSDDLTSLHYSTPNQGLPSNPERFHISAEVLGCTAFNSSSHNWEIEVGD 407609

Query:    380 KAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIF 439
                 | .|.  .|| |   | . |.|||| .  .  ..| |..|| ||| .   |||| | 
Sbjct: 407608 NEDWILGLASESVKRDQEVPARPENGFWTI-CFRDEQYRAMSSPPTALQVEKKLQRVLIQ 407432

Query:    440 LDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYF 474
              |..| ||| | | . .   .|| || |   . |||
Sbjct: 407431 LNWDKGEVVFLNPSYQEVIYTFKHA-FTEKLLPYF 407330

>Zv7_masked||Zv7_scaffold446 |chr5|Len:3556776|start:11238757|end:14795532

          Length = 3556776

 Score =  128 bits (321), Expect = 5e-028
 Identities = 67/164 (40%), Positives = 103/164 (62%), Gaps = 4/164 (2%)
 Frame = -2

Query:     313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
               | |||..||| | .| | |||. ..|. .  . ..  . .||. .|||||     .||.|
Sbjct: 2407349 LCSVDISLDPMTNHPWLQLSDDKKKVQEALSETEVSFSKQRFDSWPCVLGWEGLTSGRYY 2407170

Query:     373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYG-KEYWALTSPMTALPLRT 431
               |||.. .|  | |||   |  | |     |  |||  ..|   ....| | | | |||  
Sbjct: 2407169 WEVDIANKGYWRIGVTTASSKRHGRSPMNPSEGFW--TIWKSTRQFYACTKPETELPLTL 2406996

Query:     432 PLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS 475
                 ...|..|||. |.||||||  | | |||. | |   . | |.
Sbjct: 2406995 VPKKLGVYLDYEEGQVSFYNVETRTHIFTFT-ANFRETLFPLFA 2406867

>Zv7_masked||Zv7_scaffold733 |chr7|Len:347926|start:62913916|end:63261841

          Length = 347926

 Score =  128 bits (321), Expect = 5e-028
 Identities = 77/176 (43%), Positives = 103/176 (58%), Gaps = 5/176 (2%)
 Frame = +3

Query:    317 DVTLDPDTAYPSLILSDNLRQVRYSYLQQDL--PDNPERFNLFPCVLGSPCFIAGRHYWE 374
              .. ||| ||   | ||.. .||||   ...    | | ||.    ||    | .||||||
Sbjct: 260844 ELILDPATAQRDLCLSEDGKQVRYEEQRKNSSNSDTPRRFSPALFVLAREGFSSGRHYWE 261023

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              |.|| |  ||.|.   |  ||| .   |. ||| . |  | |  |||    || | .  |
Sbjct: 261024 VDVGHKTAWTVGLARSSARRKGEIRLNPEGGFWCLWLKNG-EVKALTGSRVALHLTSLPQ 261200

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAPLII 489
              ..||||||.||.||||.|    | .||  | |   | | ||   .  ||.  ||.|
Sbjct: 261201 KLGIFLDYEAGQVSFYDVKTHTHLYTFIDA-FTESVYPIFSPCLNQDGKNPGPLVI 261365

>Zv7_masked||Zv7_scaffold788 |chr8|Len:2644218|start:9538101|end:12182318

          Length = 2644218

 Score =  127 bits (318), Expect = 1e-027
 Identities = 64/158 (40%), Positives = 101/158 (63%), Gaps = 1/158 (0%)
 Frame = -1

Query:    305 IQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSP 364
              . .| .  |  |.|. ||.|| |||.||.. ....    .. .| |  ||. . |   | 
Sbjct: 239322 LTQLHDHPLPPVEVSFDPETANPSLLLSEDCKRLQCGLERRPVPCNLRRFDGWWCCFASQ 239143

Query:    365 CFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPM 424
               | .|||||||||||.  | .|| ..|   ||      |.|.  . |  | |  |||.| 
Sbjct: 239142 GFSSGRHYWEVEVGDR-DWRLGVAKESALCKGYRPLNTQSGYLTLRLERGSELKALTAPT 238966

Query:    425 TALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFS 462
              | ||     .|||..|||| |..|||.. .| | .|.|
Sbjct: 238965 TPLPTTLIPRRVGVYLDYDEGQLSFYDIQKRAHIYTYS 238852

>Zv7_masked||Zv7_NA211 |chrNA|Len:47979

          Length = 47979

 Score =  126 bits (316), Expect = 2e-027
 Identities = 67/158 (42%), Positives = 97/158 (61%), Gaps = 2/158 (1%)
 Frame = +2

Query:   318 VTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEV 377
             | |.|.||   . |||.|  .|||  .| ||.|||||. . |||||   ..||| |.|||
Sbjct: 46295 VILNPNTADVCVSLSDDLTTIRYSEEEQLLPENPERFSFYECVLGSEGLVSGRHSWDVEV 46474

Query:   378 GDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVG 437
             || ..| .|| ..|| ||     .|. | | | | || || | |     | |.   |.. 
Sbjct: 46475 GDCSEWALGVVKESVQRKEWFPPSPERGMWTVGL-YGGEYRARTPTSAPLKLKKKPQKIR 46651

Query:   438 IFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS 475
             . || .|| |.| .  .    . . .  |   | ||||
Sbjct: 46652 VQLDCEAGRVTFSDAADNSIIYKYKN-KFTEKVFPYFS 46762

>Zv7_masked||Zv7_scaffold1164 |chr12|Len:2996289|start:19901072|end:22897360

          Length = 2996289

 Score =  124 bits (311), Expect = 6e-027
 Identities = 61/163 (37%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = +1

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              . ||.||| |  | | .|.. ....   .. .|| . .||.  |||||   ...||||||
Sbjct: 337018 TADVSLDPMTNNPWLYVSEDHKKIQEGLIEANLPYSSQRFDSLPCVLGWEGYMSGRHYWE 337197

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYG-KEYWALTSPMTALPLRTPL 433
              ||  .   | .||   |  | |     | .|.|   ||   ....| |.| | ||     
Sbjct: 337198 VEFANNGYWRVGVTTASSKRHGRFPMNPSSGYWV--LWRSTRQFFACTNPETPLPQELVP 337371

Query:    434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSL 476
              .|.||..||. |..||||   . | .||.   |   . |.|||
Sbjct: 337372 RRMGIYIDYEEGQISFYNADNKSHIYTFT-GHFREKLYPFFSL 337497

>Zv7_masked||Zv7_scaffold1903 |chr19|Len:162695|start:33544340|end:33707034

          Length = 162695

 Score =  124 bits (311), Expect = 6e-027
 Identities = 67/187 (35%), Positives = 95/187 (50%), Gaps = 1/187 (0%)
 Frame = -1

Query:    308 LREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFI 367
              |.   .. |||                        . | ||.  |||| .  |||   | 
Sbjct: 146345 LKNRCVFPVDV........................IWQKLPNKLERFNRYLSVLGREGFS 146166

Query:    368 AGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTAL 427
              .|| |.|| |  |  ||.||  .|| ||| .  .|. | | |.|  | |  |   |   |
Sbjct: 146165 SGRFYFEVLVKGKTDWTLGVARESVDRKGDIRVSPETGSWTVALINGNELSARADPPVLL 145986

Query:    428 PLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYS-GGKSAAP 486
               ||   ||||.|.||. | | ||.|    | ....   |   . | ||  ..  ||.. |
Sbjct: 145985 SLRVSPQRVGVFVDYEEGLVCFYDVESSSHIYSYTDQCFSEKLHPCFSPGFNFEGKNSTP 145806

Query:    487 LIICPMS 493
              |||  .|
Sbjct: 145805 LIITHLS 145785

>Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3508603

          Length = 702836

 Score =  122 bits (306), Expect = 2e-026
 Identities = 69/177 (38%), Positives = 103/177 (58%), Gaps = 2/177 (1%)
 Frame = -3

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNP-ERFNLFPCVLGSPCFIAGRHYW 373
              .|.|||| |.|.| ||.|.. .|..   .|    |   . |  .  |||   | .|  |.
Sbjct: 362445 TVNVTLDADSAHPHLIVSEDGKQIKCGNIQIRKVDREIDIFTEYLGVLGKEGFSSGCFYF 362266

Query:    374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPL 433
              ||||  . || .||   |  ||   .  |.||.| | |  || |||  |    .||    
Sbjct: 362265 EVEVKGQIKWDLGVTRQSADRKELCSLNPKNGYWTVGLIDGK-YWAHESSYVFIPLSVKP 362089

Query:    434 QRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIIC 490
              ||||.|.||. | ||||.|    | ....   | | . |.  | |   ... || ||
Sbjct: 362088 QRVGVFVDYEKGFVSFYDVESMFHIYSYTGQPFNGKLCPFVCLGYYRNENSTPLKIC 361918

>Zv7_masked||Zv7_scaffold1593 |chr16|Len:1170280|start:18946598|end:20116877

          Length = 1170280

 Score =  121 bits (301), Expect = 9e-026
 Identities = 73/179 (40%), Positives = 98/179 (54%), Gaps = 6/179 (3%)
 Frame = +3

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              |..| | |||.|| | | .| .   .. |  .|  |||||||.    ||||  | .||| 
Sbjct: 421548 LFAVPVILDPNTASPWLSISPDFSSMQESRERQSFPDNPERFDPCVFVLGSEGFSSGRHR 421727

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTP 432
              ||| | |  || .|||..|| ||   |     | | . |  |  | ||||| | | |   
Sbjct: 421728 WEVRVADHPKWILGVCKESVVRKRKFTVTTTAGVWTIGLSKG-VYNALTSPRTVLNLERR 421904

Query:    433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIICP 491
               . | . .. . |||||..     |  ||.   | | . | |      |  . |. | |
Sbjct: 421905 PETVRVKVNMEKGEVSFWDTGNNKHLCTFND-KFTGKLFPIF----GPGLQSTPITILP 422066

>Zv7_masked||Zv7_scaffold1572 |chr16|Len:1454232|start:5719242|end:7173473

          Length = 1454232

 Score =  109 bits (272), Expect = 2e-022
 Identities = 70/178 (39%), Positives = 93/178 (52%), Gaps = 7/178 (3%)
 Frame = -1

Query:     318 VTLDPDTAYPSLILSDNLRQVRYSYLQQD----LPDNPERFNLFPCVLGSPCFIAGRHYW 373
               .| ||.||.| | ||     | .   ..        ||.||. . ||.||  |  |||||
Sbjct: 1112487 LTFDPETAHPLLTLSPERTAVTFEEGKETGENAAERNPKRFHYYYCVMGSEGFTHGRHYW 1112308

Query:     374 EVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPM-TALPLRTP 432
               ||||  |  | .||    | |    .|.  || | .||  |    | | |  | .   ||
Sbjct: 1112307 EVEVKGKTAWRVGVARADVHRGEMDSSSTLNGLWTLSLRNG-SITACTHPKPTPVLSYTP 1112131

Query:     433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS-LSYSGGKSAAPLII 489
                 |.|.||| |  ||||||       |.|   |   |. |...      ||. ||| |
Sbjct: 1112130 PIRIGVFLDCDNEEVSFYNAVTMNPLFSFYTGTVLVPLYPFYNPCDTDEGKNCAPLSI 1111957

>Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3508603

          Length = 702836

 Score =  109 bits (271), Expect = 3e-022
 Identities = 68/176 (38%), Positives = 104/176 (59%), Gaps = 7/176 (3%)
 Frame = -2

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              .|.|||| |.|.| ||.|.. .||.|   ..|  .|  | | .  |.|   | .|  |.|
Sbjct: 222232 TVNVTLDADSAHPDLIVSEDGKQVKYRN-REDKGNN--RLNEYLGVVGKEGFSSGCFYFE 222062

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              |.|  |  | .||  .|  ||   . .|.||.| .|  .|  | |  | .|  |   | |
Sbjct: 222061 VQVKGKTVWDLGVTRESADRKYLTSLSPKNGYWTLSQRHG-NYRA--SSVTLSPSVEP-Q 221894

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIIC 490
              |||.|.||  | |||| |    | ....  .|   . |.  | |      .|||||
Sbjct: 221893 RVGVFVDYKKGLVSFYGVESMFHIYSYTDQSFNRKLYPFVCLGYYLSFDFSPLIIC 221726

>Zv7_masked||Zv7_scaffold231 |chr3|Len:3782459|start:4839510|end:8621968

          Length = 3782459

 Score =  109 bits (271), Expect = 3e-022
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 1/145 (0%)
 Frame = +2

Query:     318 VTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEV 377
               |||||.||    .||..|  ..       ||.||||||.   |||   | .||| |.|||
Sbjct: 2234705 VTLDPNTAASCFLLSEDLTTLQCCSQTFKLPENPERFNVGAEVLGYEGFSSGRHSWDVEV 2234884

Query:     378 GDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVG 437
                .   | |||   |. |||     |  ||| . |  | || | |.| . | .    | | 
Sbjct: 2234885 KNNTYWVIGVASASISRKGKHVLTPAEGFWTIRLRNG-EYKACTAPWSPLTMTKEPQVVR 2235061

Query:     438 IFLDYDAGEVSFYNVTERCHTFTFS 462
               . || .   |.||.. ||   ||..
Sbjct: 2235062 VVLDMNRSRVTFYDLRERTPLFTYT 2235136

>Zv7_masked||Zv7_scaffold223 |chr3|Len:324853|start:1993889|end:2318741

          Length = 324853

 Score =  109 bits (270), Expect = 4e-022
 Identities = 70/174 (40%), Positives = 93/174 (53%), Gaps = 8/174 (4%)
 Frame = +1

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              |  | |||.|| | |||||.|   | .  .| || |||||. . |||||  | .|.| |.
Sbjct: 244189 SAPVILDPNTANPHLILSDDLTSGRGTGNRQPLPPNPERFDWYFCVLGSEGFNSGKHSWD 244368

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              ||| | . | .||       || |      | | |  ||  .     .      ..  |.
Sbjct: 244369 VEVKDNSGWGLGVTTAINHCKGRVFY--NTGVWCV--WYHSDE---QTKWAGFRVKEKLE 244527

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLI 488
              || . ||||.| ||| .   . |  ||.  ||   | |.|.   |      |||
Sbjct: 244528 RVRVSLDYDSGMVSFSDPVAKTHLHTFT-TTFTHSVFPFFNCGLSSFLRILPLI 244686

>Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3508603

          Length = 702836

 Score =  109 bits (270), Expect = 4e-022
 Identities = 65/176 (36%), Positives = 98/176 (55%), Gaps = 4/176 (2%)
 Frame = -3

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              .|.|||| |.|.| ||.|.. .||.     | . .   ||     |.|   | .|  |.|
Sbjct: 388365 AVNVTLDADSAHPRLIVSEDGKQVKCGD-TQTVNEGNNRFIKPLGVVGKEGFSSGCFYYE 388189

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              | |  .  | .||  .|  ||  .   | ||.| .||  |  | |  |    . |    |
Sbjct: 388188 VRVEGQTVWYLGVTRESADRKASI--FPLNGYWTMSLRNG-NYRARESSYVFISLSVSPQ 388018

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIIC 490
              |||.|.||. | ||||.     | ....  ||   . |.  | |   |.. |||||
Sbjct: 388017 RVGVFVDYEKGFVSFYDADSMSHIYSYTGQTFNEKLYPFVCLGYQRNKNSTPLIIC 387850

>Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:21986433

          Length = 288875

 Score =  107 bits (266), Expect = 1e-021
 Identities = 68/163 (41%), Positives = 88/163 (53%), Gaps = 4/163 (2%)
 Frame = -2

Query:    313 LYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHY 372
              | |  | |||.||.| |||||.|  || |  ..  |.|||||. |||||||  | .|.| 
Sbjct: 167284 LSSAPVILDPNTAHPHLILSDDLTSVRESEDKRQFPNNPERFDRFPCVLGSEGFRSGKHS 167105

Query:    373 WEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPM-TALPLRT 431
              | |||     | .||   |  |||          |.|  .      .| | . |   .  
Sbjct: 167104 WVVEVSYSFYWNLGVTTASNQRKG--RDFYDTNVWSVEYYENPPQDSLNSTVSTCFTVTQ 166931

Query:    432 PLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYF 474
               |. | . || | | ||| .     |  ||. |||   | |.|
Sbjct: 166930 KLECVKVELDCDEGTVSFSDPATDTHLHTFT-ATFTDTVFPFF 166805

>Zv7_masked||Zv7_scaffold225 |chr3|Len:702836|start:2805768|end:3508603

          Length = 702836

 Score =  106 bits (263), Expect = 2e-021
 Identities = 59/162 (36%), Positives = 93/162 (57%), Gaps = 4/162 (2%)
 Frame = -2

Query:    315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
              .|.|||| |.|.  ||.|.. .||.. .          ||  .  |.|   | .|  |.|
Sbjct: 212140 AVNVTLDADSAHRDLIVSEDGKQVKWGHTHNRKVGGNNRFTKYLGVVGKEAFSSGCFYFE 211961

Query:    375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQ 434
              |.| |.  | .||  .|   |  .. .|.|||| ||  | | | | . |   | |    |
Sbjct: 211960 VQVKDQTVWNLGVARESAEWKSSISLSPENGFWTVSKRYEK-YNASSDP---LSLSMNPQ 211793

Query:    435 RVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSL 476
              |||.|.||  | |||..|    | ....   | | . |.  |
Sbjct: 211792 RVGVFVDYKKGLVSFHDVKSMFHIYSYTGQFFIGKLYPFVCL 211667

>Zv7_masked||Zv7_scaffold241 |chr3|Len:288875|start:21697559|end:21986433

          Length = 288875

 Score =  106 bits (262), Expect = 3e-021
 Identities = 75/199 (37%), Positives = 103/199 (51%), Gaps = 25/199 (12%)
 Frame = -2

Query:   315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
             |  | || .||.| ||.||.|  || .  .  ||||||||. | |||||  | .|.| |.
Sbjct: 11998 SAPVILDSNTAHPHLIVSDDLTSVRLTEDKHPLPDNPERFDYFECVLGSVGFSSGKHRWD 11819

Query:   375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLW--YGKEYWALT-------SPMT 425
             ||| |  .||.||   |  |||         |.   .|     ||.| |       |   
Sbjct: 11818 VEVKDNDEWTVGVTTASK-RKG-------EDFYDSDIWSVENVEYFANTPQDSPNSSASN 11663

Query:   426 ALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAA 485
                ..  |. | . || | | | | .     |  ||. |||   | |.|.       |  
Sbjct: 11662 CFHVKQDLECVRVELDCDEGTVCFSDPVTDTHLHTFT-ATFTDSVFPFFT-------SLD 11507

Query:   486 PLIICPMSGIDGFSGHVGN 504
             || | |.   . |. . |.
Sbjct: 11506 PLRILPVKVSEHFTCNSGS 11450

>Zv7_masked||Zv7_scaffold1365 |chr14|Len:2230408|start:9926351|end:12156758

          Length = 2230408

 Score =  104 bits (257), Expect = 1e-020
 Identities = 67/171 (39%), Positives = 91/171 (53%), Gaps = 3/171 (1%)
 Frame = -1

Query:     321 DPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGDK 380
               | |||.||| || |  ||  |        . .||     .| .  | .| |||||.| . 
Sbjct: 1931920 DEDTAHPSLQLSRNKTQVIESNQMTSYLCDTKRFLQCVNILATEGFQSGSHYWEVDVSNN 1931741

Query:     381 AKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIFL 440
                || .||  .|| |.  |   | ||.| . |    .| | | | | | . |   |.||||
Sbjct: 1931740 PKWDLGVALESVNRQVRVKLCPDNGYWTLRLRDANQYSAGTQPWTRLTVITSPCRIGIFL 1931561

Query:     441 DYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFS--LSYSGGKSAAPLII 489
               | .  .|||||       ..||     | | |.||  .|  | |. |  |.
Sbjct: 1931560 DCEESKVSFYNADNMTLLYSFSSGP-RGKVFPFFSTCVSEHGQKAQAIRIL 1931411

>Zv7_masked||Zv7_scaffold1592 |chr16|Len:697542|start:18248956|end:18946497

          Length = 697542

 Score =  103 bits (255), Expect = 2e-020
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 1/133 (0%)
 Frame = -2

Query:      6 VAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHM 65
              .|  |     |||||  | .|. | | | .|  | .|   ...    ||.||. | .  .
Sbjct: 358832 MASALSLYLMCPVCLSDFKDPVSLPCEHVLCRQCASRYLESSKGPHKCPECRQNFTRTDL 358653

Query:     66 RPNRHLANVTQLVKQLRTERP-SGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREH 124
              .  | | ||   ... | ..    |  |  .| .|.|||||.|  ||  .|..|    .|
Sbjct: 358652 KGIRVLRNVVDAIQEQRKKKQLIQPNAEEMLCSEHKEPLKLFCVNDQRLVCLICKEGMKH 358473

Query:    125 RGHSVLPLEEAVE 137
               |||  |..|| |
Sbjct: 358472 SGHSFKPVKEAKE 358434

>Zv7_masked||Zv7_scaffold1850 |chr18|Len:1012904|start:45901656|end:46914559

          Length = 1012904

 Score =  103 bits (255), Expect = 2e-020
 Identities = 66/169 (39%), Positives = 95/169 (56%), Gaps = 9/169 (5%)
 Frame = +3

Query:    316 VDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEV 375
              .  |||||| .| |.||.  | |.||  |||  ..  |||.|| ||||     |  ||||
Sbjct: 910572 ISPTLDPDTVHPKLLLSNENRMVQYSETQQDYSEHEARFNIFPQVLGSDAIERGCCYWEV 910751

Query:    376 EVG-DKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVS--LWYGK-EYWALTSPMTALPLRT 431
              ||  |. .| .| |.  . || |     . ||.  |  | | | .  ||   . .    |
Sbjct: 910752 EVSLDEGRWKVGACDGRIGRK-GQKDVCRIGFYPNSWCLIYEKGKVEALHDKVASPVCAT 910928

Query:    432 PLQRVGIFLDYDAGEVSFYNVTE---RCHTFTFSHATFCGPVRPYFSLS 477
               ||.||. |. . | .|||.|         ..| | ||  |. |  ..|
Sbjct: 910929 DLQKVGVLLNLNEGRLSFYSVARDGALSLLYSFEH-TFSEPLYPALAVS 911072

>Zv7_masked||Zv7_scaffold2122 |chr21|Len:25789|start:44468724|end:44494512

          Length = 25789

 Score =  101 bits (251), Expect = 6e-020
 Identities = 63/161 (39%), Positives = 87/161 (54%), Gaps = 11/161 (6%)
 Frame = -3

Query:  315 SVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWE 374
            |  | |||.||   ..||..|  || |  .| ||||||||. .||||||  | .|.| |.
Sbjct: 6767 SAPVILDPNTANSHIVLSEDLTSVRESENKQWLPDNPERFD-YPCVLGSVGFCSGKHRWD 6591

Query:  375 VEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLW--YGKEYWALTSPMTALPLRTP 432
            ||| .   |..||   |  ||  |       |.   .|  .   |  . |     |.   
Sbjct: 6590 VEVKESRCWSVGVTTASNQRKRDV-------FFNTDVWSVWHDPYGLIKSSSNEFPVEQY 6432

Query:  433 LQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPY 473
            |. | . |||| | | | .     |  ||.  ||   | |.
Sbjct: 6431 LECVRVELDYDRGTVCFSDPVNNTHLHTFT-TTFTDAVFPF 6312

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,279,395
Number of Sequences: 7494
Number of Extensions: 807279395
Number of Successful Extensions: 35475885
Number of sequences better than 0.0: 0
TBLASTN 7.6.0