BLASTP 7.6.0


Query=uc002kjr |17_random|BC066308|NA|NA|ANAPC11|NA|NA|Homo sapiens putative
       anaphase-promoting complex subunit APC11 mRNA, complete cds
        (133 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end...    103   1e-021
Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end...     86   2e-016

>Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end:44158972

          Length = 1894711

 Score =  103 bits (256), Expect = 1e-021
 Identities = 40/43 (93%), Positives = 42/43 (97%)
 Frame = -2

Query:     38 KVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEW 80
              |||||||||||||||||||||||||||..||||| ||||||||
Sbjct: 142188 KVPGDDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEW 142060

>Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end:44158972

          Length = 1894711

 Score =  86 bits (211), Expect = 2e-016
 Identities = 41/72 (56%), Positives = 45/72 (62%), Gaps = 5/72 (6%)
 Frame = -2

Query:      1 MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHC-----F 55
              |||||| |||||.|||||||||||||| .||||||||  |    |     |  |      
Sbjct: 146529 MKVKIKQWNGVASWLWVANDENCGICRASFNGCCPDCG*PDYTSPTNTILCHLCVLSFTI 146350

Query:     56 HMHCILKWLHAQ 67
                  |.|  |.|
Sbjct: 146349 KSRFIIKQCHSQ 146314

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,506,260,169
Number of Sequences: 7494
Number of Extensions: 1506260169
Number of Successful Extensions: 64191448
Number of sequences better than 0.0: 0
TBLASTN 7.6.0