BLASTP 7.6.0


Query=uc002kjo |17_random|NM_001002244|NA|NA|ANAPC11|NA|NA|Homo sapiens
       putative anaphase-promoting complex subunit APC11 mRNA, complete cds
        (196 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end...     84   3e-015

>Zv7_masked||Zv7_scaffold632 |chr6|Len:1894711|start:42264262|end:44158972

          Length = 1894711

 Score =  84 bits (205), Expect = 3e-015
 Identities = 33/37 (89%), Positives = 35/37 (94%)
 Frame = -2

Query:      1 MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDC 37
              |||||| |||||.|||||||||||||| .||||||||
Sbjct: 146529 MKVKIKQWNGVASWLWVANDENCGICRASFNGCCPDC 146419

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,506,260,169
Number of Sequences: 7494
Number of Extensions: 1506260169
Number of Successful Extensions: 64191448
Number of sequences better than 0.0: 0
TBLASTN 7.6.0