BLASTP 7.6.0


Query=uc002kjc |17_random|NM_000160|NA|NA|GCGR|NM_000160|NP_000151|glucagon
       receptor
        (477 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:5...     75   3e-012
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     74   1e-011
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     73   2e-011
Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:5...     69   2e-010
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     69   4e-010
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     67   1e-009
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     65   3e-009
Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|e...     64   1e-008
Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|e...     64   1e-008
Zv7_masked||Zv7_scaffold899 |chr9|Len:1376450|start:965704|end:2...     62   4e-008
Zv7_masked||Zv7_scaffold649 |chr6|Len:1395528|start:55413755|end...     61   8e-008
Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:5...     60   1e-007
Zv7_masked||Zv7_scaffold2332 |chr24|Len:1331695|start:25320558|e...     60   1e-007
Zv7_masked||Zv7_scaffold2567 |chrUn|Len:208360                          60   1e-007
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     57   2e-006
Zv7_masked||Zv7_scaffold1141 |chr12|Len:847193|start:2926746|end...     55   3e-006
Zv7_masked||Zv7_scaffold1149 |chr12|Len:4625943|start:6162694|en...     55   6e-006
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     54   1e-005
Zv7_masked||Zv7_scaffold94 |chr2|Len:450322|start:905259|end:135...     53   2e-005
Zv7_masked||Zv7_scaffold98 |chr2|Len:43182|start:2072416|end:211...     53   2e-005
Zv7_masked||Zv7_scaffold2164 |chr22|Len:515512|start:9242306|end...     53   2e-005
Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end...     52   3e-005
Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end...     52   3e-005
Zv7_masked||Zv7_scaffold2332 |chr24|Len:1331695|start:25320558|e...     52   4e-005
Zv7_masked||Zv7_scaffold2567 |chrUn|Len:208360                          52   4e-005
Zv7_masked||Zv7_scaffold1134 |chr12|Len:577629|start:1|end:577629       51   6e-005
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     49   3e-004
Zv7_masked||Zv7_scaffold580 |chr6|Len:1648376|start:9398440|end:...     49   3e-004
Zv7_masked||Zv7_scaffold1141 |chr12|Len:847193|start:2926746|end...     48   5e-004
Zv7_masked||Zv7_scaffold1239 |chr12|Len:430955|start:46578013|en...     48   7e-004
Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:...     47   9e-004
Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:5...     47   9e-004
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     47   0.002
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     46   0.003
Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|en...     45   0.003
Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|e...     45   0.006
Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|e...     45   0.006
Zv7_masked||Zv7_scaffold649 |chr6|Len:1395528|start:55413755|end...     45   0.006

>Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:51947337

          Length = 207435

 Score =  75 bits (184), Expect = 3e-012
 Identities = 33/53 (62%), Positives = 39/53 (73%)
 Frame = -2

Query:    221 VAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              | ||| | | ||| ..|| |||||||||||.||      ||..| .|| ||||
Sbjct: 127430 VVGCRSAMVMMQYSVMANNCWLLVEGLYLHSLLVTTVFSERNYFCIYLCIGWG 127272

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  74 bits (179), Expect = 1e-011
 Identities = 34/48 (70%), Positives = 41/48 (85%)
 Frame = -2

Query:    345 FRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQ 392
              |||||||||||||||.|||||| .|.|  .| ||.  |||.|| .|||
Sbjct: 930348 FRLAKSTLTLIPLLGIHEVVFAVMTEEQTEGVLRNVNLFFELFFNSFQ 930205

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  73 bits (177), Expect = 2e-011
 Identities = 34/57 (59%), Positives = 39/57 (68%)
 Frame = -2

Query:    217 SDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              |   ..||||| | ||| . ||| ||||||||||||| |    | |.  .|  ||||
Sbjct: 933687 SSQVMSGCRVAQVLMQYCVGANYYWLLVEGLYLHNLLVLMVFSENSYICVYFFIGWG 933517

>Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:51947337

          Length = 207435

 Score =  69 bits (168), Expect = 2e-010
 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = -2

Query:     56 LVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHK---VQHR 94
              ||||||||.| ||||    || |.||||||||. |   .|||
Sbjct: 129347 LVCNRTFDQYVCWPDGLPGTTVNVSCPWYLPWYSKGRPLQHR 129222

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  69 bits (166), Expect = 4e-010
 Identities = 23/33 (69%), Positives = 29/33 (87%)
 Frame = +2

Query:     56 LVCNRTFDKYSCWPDTPANTTANISCPWYLPWH 88
              .|||||||.|.||||   ||| ...||||||||
Sbjct: 235277 VVCNRTFDRYACWPDALPNTTVSVACPWYLPWH 235375

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  67 bits (162), Expect = 1e-009
 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 3/51 (5%)
 Frame = +3

Query:    345 FRLAKSTLTLIPLLGVHEVVFAFVTDE---HAQGTLRSAKLFFDLFLSSFQ 392
              |||||||||||||||.| |.|.|||||   |    ||  ||| ||| .|||
Sbjct: 264909 FRLAKSTLTLIPLLGIHSVLFSFVTDESTSHGALPLRLTKLFIDLFFNSFQ 265061

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  65 bits (158), Expect = 3e-009
 Identities = 29/51 (56%), Positives = 33/51 (64%)
 Frame = +1

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||||| | ||| |.||  ||||||.|||.|| .  | ||         |||
Sbjct: 242017 GCRVAVVMMQYSILANSYWLLVEGIYLHSLLVVTVLTER.........GWG 242169

>Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|end:13671294

          Length = 2435517

 Score =  64 bits (153), Expect = 1e-008
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = -3

Query:     223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
               ||.   || || |.|.. ||||||||.| || ..   || .|  |. ||||
Sbjct: 2032075 GCKAVIVFFQYCIMASFFWLLVEGLYIHALLAVSFFSERKYFWCYILIGWG 2031923

>Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|end:13671294

          Length = 2435517

 Score =  64 bits (153), Expect = 1e-008
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = -3

Query:     223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
               ||.   || || |.|.. ||||||||.| || ..   || .|  |. ||||
Sbjct: 1968484 GCKAVIVFFQYCIMASFFWLLVEGLYIHALLAVSFFSERKYFWCYILIGWG 1968332

>Zv7_masked||Zv7_scaffold899 |chr9|Len:1376450|start:965704|end:2342153

          Length = 1376450

 Score =  62 bits (149), Expect = 4e-008
 Identities = 29/78 (37%), Positives = 40/78 (51%)
 Frame = -1

Query:    209 DLSVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYL 268
              |.|.       .   |. |  | |. |. || |||||||||  || |  . .| .|  |.
Sbjct: 281525 DVSL......CSQVLCKSAVTFFQFCILTNYFWLLVEGLYLQTLLALTFVSQRKYFWWYI 281346

Query:    269 GIGWGAPMLFVVPWAVVK 286
               ||||.           |
Sbjct: 281345 LIGWGS..........HK 281292

>Zv7_masked||Zv7_scaffold649 |chr6|Len:1395528|start:55413755|end:56809282

          Length = 1395528

 Score =  61 bits (146), Expect = 8e-008
 Identities = 25/50 (50%), Positives = 34/50 (68%)
 Frame = -2

Query:     224 CRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
               |. |  | |. |.||| ||||||.||  || |  . .. .|  |. ||||
Sbjct: 1027889 CKAAVAFFQFSILANYFWLLVEGMYLQTLLALTFVSQKKYFWWYILIGWG 1027740

>Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:51947337

          Length = 207435

 Score =  60 bits (145), Expect = 1e-007
 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 3/68 (4%)
 Frame = -1

Query:    346 RLAKSTLTLIPLLGVHEVVFAFVTDEHA--QGTLRSAKLFFDLFLSSFQGLLV-AVLYCF 402
              ||||||||||||||.| |.| || ||    .  ||  .||.||  |||| |     |  .
Sbjct: 117135 RLAKSTLTLIPLLGIHAVLFTFVIDESVPKESLLRLIRLFYDLLFSSFQVLRAPQSLTDY 116956

Query:    403 LNKEVQSE 410
              | .|.  |
Sbjct: 116955 LKEELHDE 116932

>Zv7_masked||Zv7_scaffold2332 |chr24|Len:1331695|start:25320558|end:26652252

          Length = 1331695

 Score =  60 bits (144), Expect = 1e-007
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = -1

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPML 277
              ||.|. | . | |.||. |||||||||| || .    |   | .|| ||||   |
Sbjct: 853459 GCKVSLVILNYFIMANFYWLLVEGLYLHTLL-MVIFSENRHFIIYLLIGWGKSSL 853298

>Zv7_masked||Zv7_scaffold2567 |chrUn|Len:208360

          Length = 208360

 Score =  60 bits (144), Expect = 1e-007
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = -3

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPML 277
              ||.|. | . | |.||. |||||||||| || .    |   | .|| ||||   |
Sbjct: 156119 GCKVSLVILNYFIMANFYWLLVEGLYLHTLL-MVIFSENRHFIIYLLIGWGKSSL 155958

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  57 bits (135), Expect = 2e-006
 Identities = 20/36 (55%), Positives = 22/36 (61%)
 Frame = -3

Query:     53 PTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWH 88
              |  | |   || |.|| |   |||  . ||||||||
Sbjct: 943733 PLGLFCKSMFDMYACWTDGVPNTTVKVPCPWYLPWH 943626

>Zv7_masked||Zv7_scaffold1141 |chr12|Len:847193|start:2926746|end:3773938

          Length = 847193

 Score =  55 bits (132), Expect = 3e-006
 Identities = 23/50 (46%), Positives = 32/50 (64%)
 Frame = +3

Query:   224 CRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
             |. .  | || ...|. |||||||||  ||      .|.||  |  .|||
Sbjct: 34734 CKASVTFFQYCVLSNFYWLLVEGLYLQTLLTFTFAHKRTFFWCYTLVGWG 34883

>Zv7_masked||Zv7_scaffold1149 |chr12|Len:4625943|start:6162694|end:10788636

          Length = 4625943

 Score =  55 bits (130), Expect = 6e-006
 Identities = 26/62 (41%), Positives = 37/62 (59%)
 Frame = -3

Query:     223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPW 282
               ||. |     | .  |. |.||||||||.|. .| | ...       ||||   |||.  
Sbjct: 1030384 GCKAAVTLFLYLLATNHYWILVEGLYLHSLIFMAFLSDKNCLWALTIIGWGELALFVLQI 1030205

Query:     283 AV 284
               ||
Sbjct: 1030204 AV 1030199

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  54 bits (127), Expect = 1e-005
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 4/80 (5%)
 Frame = +2

Query:    271 GWGAPML--FVVPWA-VVKCLFENVQCWTSNDNMGFWW-ILRFPVFLAILINFFIFVRIV 326
              || |     |. | . .. |.   . |     ||  |     . ||  | ||||||. |.
Sbjct: 263483 GWTAVSTAHFLPPQS*LICCVVRKL*CQFCPANMM*WS*PGHYDVFFFIQINFFIFIHII 263662

Query:    327 QLLVAKLRARQMHHTDYKFR 346
              ..||.|||| || ..|||||
Sbjct: 263663 KILVSKLRAHQMRYSDYKFR 263722

>Zv7_masked||Zv7_scaffold94 |chr2|Len:450322|start:905259|end:1355580

          Length = 450322

 Score =  53 bits (126), Expect = 2e-005
 Identities = 22/51 (43%), Positives = 31/51 (60%)
 Frame = -2

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||.||     | .  || |.||||||||.|. .    .| .   .  ||||
Sbjct: 299937 GCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWG 299785

>Zv7_masked||Zv7_scaffold98 |chr2|Len:43182|start:2072416|end:2115597

          Length = 43182

 Score =  53 bits (126), Expect = 2e-005
 Identities = 22/51 (43%), Positives = 31/51 (60%)
 Frame = +1

Query:   223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
             ||.||     | .  || |.||||||||.|. .    .| .   .  ||||
Sbjct: 39424 GCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWG 39576

>Zv7_masked||Zv7_scaffold2164 |chr22|Len:515512|start:9242306|end:9757817

          Length = 515512

 Score =  53 bits (125), Expect = 2e-005
 Identities = 21/51 (41%), Positives = 32/51 (62%)
 Frame = -2

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||..  .|  | .  || |.||||||||.|. .|   .  .   .  ||||
Sbjct: 272295 GCKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKYLWGFTLIGWG 272143

>Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end:27981893

          Length = 5306314

 Score =  52 bits (124), Expect = 3e-005
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = -1

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||.|  .   | .  || |.||||||||.|. .| | .  .   .  ||||
Sbjct: 445669 GCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDSKYLWGFTLIGWG 445517

>Zv7_masked||Zv7_scaffold917 |chr9|Len:5306314|start:22675580|end:27981893

          Length = 5306314

 Score =  52 bits (124), Expect = 3e-005
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = -1

Query:    223 GCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||.|  .   | .  || |.||||||||.|. .| | .  .   .  ||||
Sbjct: 487555 GCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDSKYLWGFTLIGWG 487403

>Zv7_masked||Zv7_scaffold2332 |chr24|Len:1331695|start:25320558|end:26652252

          Length = 1331695

 Score =  52 bits (123), Expect = 4e-005
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query:    346 RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQ 392
              ||||||| |||| ||| .|| .. |    |   . |.|||| | |||
Sbjct: 846561 RLAKSTLLLIPLFGVHYIVFVYIID--GNGERENYKIFFDLGLGSFQ 846427

>Zv7_masked||Zv7_scaffold2567 |chrUn|Len:208360

          Length = 208360

 Score =  52 bits (123), Expect = 4e-005
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -1

Query:    346 RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQ 392
              ||||||| |||| ||| .|| .. |    |   . |.|||| | |||
Sbjct: 149509 RLAKSTLLLIPLFGVHYIVFVYIID--GNGERENYKIFFDLGLGSFQ 149375

>Zv7_masked||Zv7_scaffold1134 |chr12|Len:577629|start:1|end:577629

          Length = 577629

 Score =  51 bits (121), Expect = 6e-005
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = +1

Query:    224 CRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              |. . | ..| .  || ||||| ..|| ||  | |  ..    |. ||||
Sbjct: 289441 CKASKVSLEYFVGCNYFWLLVEAVFLHTLLFTAVLTRKTLLKKYIFIGWG 289590

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  49 bits (115), Expect = 3e-004
 Identities = 19/30 (63%), Positives = 27/30 (90%)
 Frame = -3

Query:    317 INFFIFVRIVQLLVAKLRARQMHHTDYKFR 346
              .|||||.||. .|..||.| || .||||||
Sbjct: 931304 VNFFIFIRIILILISKLKAHQMRYTDYKFR 931215

>Zv7_masked||Zv7_scaffold580 |chr6|Len:1648376|start:9398440|end:11046815

          Length = 1648376

 Score =  49 bits (115), Expect = 3e-004
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +2

Query:     224 CRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGA 274
               |.|.     | .  || |.| ||.||| |. .|   |.     |  .||||
Sbjct: 1319705 CKVSVFIHHYLLGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGA 1319857

>Zv7_masked||Zv7_scaffold1141 |chr12|Len:847193|start:2926746|end:3773938

          Length = 847193

 Score =  48 bits (113), Expect = 5e-004
 Identities = 31/57 (54%), Positives = 37/57 (64%), Gaps = 5/57 (8%)
 Frame = +1

Query:   346 RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGL-LVAVLYC 401
             ||||||| |||| ||| .||| .  ||       |.|||.| | |||   ..  |||
Sbjct: 36436 RLAKSTLLLIPLFGVHYIVFA-LFPEHVG---LEARLFFELVLGSFQVFAMLC*LYC 36594

>Zv7_masked||Zv7_scaffold1239 |chr12|Len:430955|start:46578013|end:47008967

          Length = 430955

 Score =  48 bits (112), Expect = 7e-004
 Identities = 22/93 (23%), Positives = 34/93 (36%)
 Frame = -3

Query:    181 FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC 240
              |   .  .|                                  |. | ||  | ...|. 
Sbjct: 109317 FLPLLCFSS................................VACKTAVVFCHYCVMSNFF 109138

Query:    241 WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWG 273
              ||||| .||..||    |  |     .  .|||
Sbjct: 109137 WLLVEAVYLNSLLVSVFLRRRRCLWAFALLGWG 109039

>Zv7_masked||Zv7_scaffold233 |chr3|Len:2425238|start:9024689|end:11449926

          Length = 2425238

 Score =  47 bits (111), Expect = 9e-004
 Identities = 21/42 (50%), Positives = 29/42 (69%)
 Frame = +2

Query:    170 HCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLS 211
              || || || ||||||.|.|||.|. | |     .  .| |..
Sbjct: 240155 HCMRNNIHMNLFASFILRASSILIKDALSERPDTFPVGQDIT 240280

>Zv7_masked||Zv7_scaffold68 |chr1|Len:207435|start:51739903|end:51947337

          Length = 207435

 Score =  47 bits (111), Expect = 9e-004
 Identities = 19/30 (63%), Positives = 27/30 (90%)
 Frame = -1

Query:    317 INFFIFVRIVQLLVAKLRARQMHHTDYKFR 346
              ||| ||.||...|..||.| || .||||||
Sbjct: 119514 INFIIFIRIIKILMSKLKAHQMRYTDYKFR 119425

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  47 bits (109), Expect = 0.002
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = -1

Query:     91 VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEE 127
              |.. || . |||||||.       ||| |||  || .
Sbjct: 942562 VRNGFVSRECGPDGQWLTVNHSSTWRDHSQCNADGRQ 942452

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  46 bits (107), Expect = 0.003
 Identities = 15/27 (55%), Positives = 22/27 (81%)
 Frame = -1

Query:    293 QCWTSNDNMGFWWILRFPVFLAILINF 319
              .||  |.|| .|||.| |. ||||..|
Sbjct: 931930 RCWEINENMAYWWIIRTPILLAILVSF 931850

>Zv7_masked||Zv7_scaffold1494 |chr15|Len:988123|start:29924071|end:30912193

          Length = 988123

 Score =  45 bits (106), Expect = 0.003
 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = -3

Query:    171 CTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSD 218
              |||| || ||||||.|.| |.|  | ||  . . .  |.  ||  |||
Sbjct: 937475 CTRNYIHTNLFASFILRAVSILTRDALL-MKDAPEFRDNKDVSIVLSD 937335

>Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|end:13671294

          Length = 2435517

 Score =  45 bits (104), Expect = 0.006
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 4/47 (8%)
 Frame = -2

Query:     346 RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQ 392
               ||||||| |||| |.. ..|||.  |. .  ||   | ||| | |||
Sbjct: 1960898 RLAKSTLLLIPLFGINFIIFAFI-PENIKTELR---LVFDLILGSFQ 1960770

>Zv7_masked||Zv7_scaffold2322 |chr24|Len:2435517|start:11235778|end:13671294

          Length = 2435517

 Score =  45 bits (104), Expect = 0.006
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 4/47 (8%)
 Frame = -3

Query:     346 RLAKSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQ 392
               ||||||| |||| |.. ..|||.  |. .  ||   | ||| | |||
Sbjct: 2024491 RLAKSTLLLIPLFGINFIIFAFI-PENIKTELR---LVFDLILGSFQ 2024363

>Zv7_masked||Zv7_scaffold649 |chr6|Len:1395528|start:55413755|end:56809282

          Length = 1395528

 Score =  45 bits (104), Expect = 0.006
 Identities = 18/29 (62%), Positives = 24/29 (82%)
 Frame = -2

Query:     170 HCTRNAIHANLFASFVLKASSVLVIDGLL 198
               ||||| || ||||||.|.||.. . | .|
Sbjct: 1032938 HCTRNYIHINLFASFILRASAIFIKDAVL 1032852

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,506,260,169
Number of Sequences: 7494
Number of Extensions: 1506260169
Number of Successful Extensions: 64191448
Number of sequences better than 0.0: 0
TBLASTN 7.6.0