BLASTP 7.6.0


Query=uc002kio |17_random|AK225985|NA|NA|PRC17|NA|NA|Homo sapiens Rab
       GTPase-activating protein PRC17 (PRC17) mRNA, complete cds
        (472 letters)

Database: Zv7_masked;
          7,494 sequences; 480,106,604 total letters
                                                                  Score    E

Zv7_masked||Zv7_scaffold361 |chr4|Len:4659564|start:25927427|end...     62   4e-008
Zv7_masked||Zv7_scaffold2435 |chr25|Len:3147528|start:17874910|e...     58   5e-007
Zv7_masked||Zv7_scaffold717 |chr7|Len:2772546|start:43452824|end...     54   7e-006
Zv7_masked||Zv7_scaffold18 |chr1|Len:5418810|start:11835760|end:...     54   1e-005

>Zv7_masked||Zv7_scaffold361 |chr4|Len:4659564|start:25927427|end:30586990

          Length = 4659564

 Score =  62 bits (149), Expect = 4e-008
 Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 2/47 (4%)
 Frame = +1

Query:     183 EVGYCRDLSHIAALFLLYFPEEDAFWALVQLLASERHSLQG--FHSP 227
               |||||. .| | || |.|  |||||||||.||. .||.. |  |.||
Sbjct: 1007452 EVGYCQGMSQITALLLIYMNEEDAFWALVKLLSGQRHTMHGINFYSP 1007592

>Zv7_masked||Zv7_scaffold2435 |chr25|Len:3147528|start:17874910|end:21022437

          Length = 3147528

 Score =  58 bits (139), Expect = 5e-007
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +3

Query:     183 EVGYCRDLSHIAALFLLYFPEEDAFWALVQLLASERHSLQG-FHSPN 228
               || ||. .| |||. |.|  |||||||| ||| ...|.. |  || |
Sbjct: 2583453 EVSYCQGMSQIAAILLMYMNEEDAFWALSQLLTNQKHAMHGKLHSSN 2583593

>Zv7_masked||Zv7_scaffold717 |chr7|Len:2772546|start:43452824|end:46225369

          Length = 2772546

 Score =  54 bits (129), Expect = 7e-006
 Identities = 22/41 (53%), Positives = 31/41 (75%)
 Frame = +3

Query:     183 EVGYCRDLSHIAALFLLYFPEEDAFWALVQLLASERHSLQG 223
               || ||. .| |||. |..  |||||||| ||| ...| . |
Sbjct: 1164291 EVSYCQGMSQIAAILLMFMNEEDAFWALSQLLTNQKHGMHG 1164413

>Zv7_masked||Zv7_scaffold18 |chr1|Len:5418810|start:11835760|end:17254569

          Length = 5418810

 Score =  54 bits (127), Expect = 1e-005
 Identities = 27/63 (42%), Positives = 37/63 (58%)
 Frame = -1

Query:     152 TLRKHMFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYFPEEDAFWALV 211
               |   | .|  . |  |  | ..| ||   .||||||. || .| . ||.  |||||  | 
Sbjct: 2703987 TFPTHPYFSAQLGAGQLSLYNLLKAYSLLDPEVGYCQGLSFVAGVLLLHMSEEDAFHMLK 2703808

Query:     212 QLL 214
                |.
Sbjct: 2703807 FLM 2703799

 
    Posted date:  Tue Aug 07 17:35:53 2007
  Number of letters in database: 480,106,604
  Number of sequences in database:  7,494

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,506,260,169
Number of Sequences: 7494
Number of Extensions: 1506260169
Number of Successful Extensions: 64191448
Number of sequences better than 0.0: 0
TBLASTN 7.6.0