BLASTP 7.6.0


Query=uc002zka
       |21_random|NM_001033515|Q6GMR3|Q6GMR3_HUMAN|LOC389833|NM_001033515|NP_00
       1028687|hypothetical protein LOC389833
        (129 letters)

Database: fugu4Protein;
          26,721 sequences; 11,853,787 total letters
                                                                  Score    E

fugu4Protein||fugu4_602056 |jgi|Takru4|602056|e_gw2.189.156.1           92   6e-020
fugu4Protein||fugu4_566308 |jgi|Takru4|566308|e_gw2.134.37.1            84   2e-017
fugu4Protein||fugu4_745828 |jgi|Takru4|745828|fgh5_pg.C_scaffold...     67   3e-012
fugu4Protein||fugu4_708283 |jgi|Takru4|708283|fgh5_pm.C_scaffold...     30   0.464
fugu4Protein||fugu4_594110 |jgi|Takru4|594110|e_gw2.9.386.1             27   2.301
fugu4Protein||fugu4_745184 |jgi|Takru4|745184|fgh5_pg.C_scaffold...     27   2.301
fugu4Protein||fugu4_586316 |jgi|Takru4|586316|e_gw2.6.198.1             27   3.925
fugu4Protein||fugu4_593149 |jgi|Takru4|593149|e_gw2.398.17.1            27   3.925

>fugu4Protein||fugu4_602056 |jgi|Takru4|602056|e_gw2.189.156.1

          Length = 445

 Score =  92 bits (228), Expect = 6e-020
 Identities = 52/116 (44%), Positives = 76/116 (65%), Gaps = 6/116 (5%)

Query:  20 PRSASTPE------TRTKFTQDNLCHAQRERLDSANLWVLVDCILRDTSEDLGLQCDAVN 73
           | |||  |      .  .||| ||  || |   . .|  | . ||.||.||| .||  |.
Sbjct: 240 PGSASMQEQLCNSASWAEFTQVNLSKAQHEHQTTQSLRALAEGILQDTTEDLRVQCSRVD 299

Query:  74 LAFGCRCEELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKDKEEPLHIAQTRL 129
            ||  ||||| .|. .|.  | ..| .| ||| |.|.|..|. .|| || .||.||
Sbjct: 300 QAFSRRCEELVEAKTQLEVKLAQILEQIGDQETNIVSLEQAVHNKEAPLRVAQSRL 355

>fugu4Protein||fugu4_566308 |jgi|Takru4|566308|e_gw2.134.37.1

          Length = 488

 Score =  84 bits (207), Expect = 2e-017
 Identities = 46/111 (41%), Positives = 68/111 (61%)

Query:  19 LPRSASTPETRTKFTQDNLCHAQRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGC 78
           |  | | ||. ..|| ||.  .| ||  |  |   .. ..  || ..  | . ||.||  
Sbjct: 287 LDPSLSLPESWSRFTDDNILRSQSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSN 346

Query:  79 RCEELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKDKEEPLHIAQTRL 129
           |  |  ||.. || || | |.||   |  . .|| |...|| || .|||||
Sbjct: 347 RTSETADAKNSLQTHLAKTLQEIFQTEMLIESLKRAVREKESPLKVAQTRL 397

>fugu4Protein||fugu4_745828 |jgi|Takru4|745828|fgh5_pg.C_scaffold_3021000001

          Length = 343

 Score =  67 bits (162), Expect = 3e-012
 Identities = 37/89 (41%), Positives = 54/89 (60%)

Query:  41 QRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKMLRE 100
           | ||  |  |   .. ..  || ..  | . ||.||  |  |  ||.. || || | |.|
Sbjct: 164 QSERAASHKLRDEIEILMNATSGEMWNQFNCVNVAFSNRTSETADAKNSLQTHLAKTLQE 223

Query: 101 ITDQEHNVVALKEAIKDKEEPLHIAQTRL 129
           |   |  . .|| |...|| || .|||||
Sbjct: 224 IFQTEMLIESLKRAVREKESPLKVAQTRL 252

>fugu4Protein||fugu4_708283 |jgi|Takru4|708283|fgh5_pm.C_scaffold_7000090

          Length = 330

 Score =  30 bits (65), Expect = 0.464
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query:  39 HAQRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKML 98
           ||.  ||      .  .  .| .    | .     |    ||||||    | .    ..|
Sbjct:  34 HAEIRRLQQQCTDLTYELTMRSSDPSDGSEARCRELQ--RRCEELEAELKKKEEENTELL 91

Query:  99 REITDQEHNVVALKEAIKDKEE 120
           |..  .   .  |.  ||..|.
Sbjct:  92 RDLEQKNAMISVLENTIKEREK 113

>fugu4Protein||fugu4_594110 |jgi|Takru4|594110|e_gw2.9.386.1

          Length = 1396

 Score =  27 bits (59), Expect = 2.301
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query:  79 RCEELEDARHKLQHHL---HKMLREITDQEHNVVALKEAIKDKEEPL 122
           |  ..|    ||.  |   .|   |. .||  . |||| |.. |. |
Sbjct: 118 RMHDIETENAKLRETLEDYNKEFAEVKNQEVTIKALKEKIREYEQSL 164

>fugu4Protein||fugu4_745184 |jgi|Takru4|745184|fgh5_pg.C_scaffold_2453000001

          Length = 1815

 Score =  27 bits (59), Expect = 2.301
 Identities = 12/49 (24%), Positives = 28/49 (57%)

Query:  81 EELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKDKEEPLHIAQTRL 129
           ..||||  .|.  | .   .  .    .  ||. .. .|. | .|. .|
Sbjct: 492 KQLEDAAKELKDKLRQAAEQNREARREISELKKNLEKREDELSLARAQL 540

>fugu4Protein||fugu4_586316 |jgi|Takru4|586316|e_gw2.6.198.1

          Length = 568

 Score =  27 bits (57), Expect = 3.925
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query:  79 RCEELE-----DARHKLQHHLHKMLREITDQEHNVVALKEAIKD 117
           || |..      |.  |||   |. . ..     .|| |||||.
Sbjct: 521 RCLEMDVDRRGSAKELLQHSFLKLAKPLSSLTPLIVAAKEAIKN 564

>fugu4Protein||fugu4_593149 |jgi|Takru4|593149|e_gw2.398.17.1

          Length = 1938

 Score =  27 bits (57), Expect = 3.925
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query:   59 RDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKD 117
            |    || |  |..   |  . |||||   |    |  .  .| |..  || |.. .|.
Sbjct: 1059 RKLEGDLKLSMDSLK-DFENQKEELEDRLKKKDIELAHLQAKIEDEQSLVVQLQKRLKE 1116

 
    Posted date:  Tue Aug 14 13:05:13 2007
  Number of letters in database: 11,853,787
  Number of sequences in database:  26,721

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 131,752,370
Number of Sequences: 26721
Number of Extensions: 131752370
Number of Successful Extensions: 10448544
Number of sequences better than 0.0: 0
BLASTP 7.6.0