BLASTP 7.6.0


Query=fugu4_747710 |jgi|Takru4|747710|fgh5_pg.C_scaffold_7473000002
        (253 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001str |12|NM_006482|Q9BRB5|Q9BRB5_HUMAN|DYRK2|NM_006482...     72   6e-013
hg18||uc001sts |12|NM_003583|Q92630|DYRK2_HUMAN|DYRK2|NM_003583|...     72   6e-013
hg18||uc002omi |19|NM_006484|Q9Y463-3|Q9Y463-3|DYRK1B|NM_006484|...     67   2e-011
hg18||uc002omj |19|NM_004714|Q9Y463|DYR1B_HUMAN|DYRK1B|NM_004714...     67   2e-011
hg18||uc002omk |19|NM_006483|Q9Y463-2|Q9Y463-2|DYRK1B|NM_006483|...     67   2e-011
hg18||uc001hei |1|NM_001004023|Q9HBY6|Q9HBY6_HUMAN|DYRK3|NM_0010...     66   3e-011
hg18||uc001hej |1|NM_003582|Q9HBY7|Q9HBY7_HUMAN|DYRK3|NM_003582|...     66   3e-011
hg18||uc002ywi |21|NM_101395|Q13627-5|Q13627-5|DYRK1A|NM_101395|...     65   7e-011
hg18||uc002ywj |21|NM_130436|Q13627-2|Q13627-2|DYRK1A|NM_130436|...     65   7e-011
hg18||uc002ywk |21|NM_001396|Q13627|DYR1A_HUMAN|DYRK1A|NM_001396...     65   7e-011
hg18||uc002ywl |21|NM_130437|Q13627-3|Q13627-3|DYRK1A|NM_130437|...     65   7e-011
hg18||uc002ywm |21|NM_130438|Q13627-3|Q13627-3|DYRK1A|NM_130438|...     65   7e-011
hg18||uc002onp |19|NM_144685|Q8NE63|HIPK4_HUMAN|HIPK4|NM_144685|...     65   9e-011
hg18||uc003vve |7|NM_022740|NA|NA|HIPK2|NM_022740|NP_073577|home...     62   6e-010
hg18||uc003vvf |7|AF208291|Q9H2X6|HIPK2_HUMAN|HIPK2|NA|NA|Homeod...     62   6e-010
hg18||uc003vvg |7|AF326592|Q9H2X6-3|Q9H2X6-3|HIPK2|NA|NA|Homeodo...     62   6e-010
hg18||uc001eel |1|NM_152696|Q86Z02-2|Q86Z02-2|HIPK1|NM_152696|NP...     61   1e-009
hg18||uc001eem |1|NM_198268|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|N...     61   1e-009
hg18||uc001een |1|AB089957|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP...     61   1e-009
hg18||uc001eeo |1|NM_198269|Q86Z02-3|Q86Z02-3|HIPK1|NM_198269|NP...     61   1e-009
hg18||uc001mul |11|NM_005734|Q9H422|HIPK3_HUMAN|HIPK3|NM_005734|...     61   1e-009
hg18||uc001mum |11|NM_001048200|Q9H422-2|Q9H422-2|HIPK3|NM_00104...     61   1e-009
hg18||uc003mvv |6|NM_003913|Q5TAY8|Q5TAY8_HUMAN|PRPF4B|NM_003913...     55   6e-008
hg18||uc001qmx |12|NM_003845|Q9NR20|DYRK4_HUMAN|DYRK4|NM_003845|...     51   1e-006
hg18||uc001qmy |12|AF263541|Q9NR20-2|Q9NR20-2|DYRK4|NM_003845|NP...     51   1e-006
hg18||uc001qmz |12|CR615549|NA|NA|DYRK4|NM_003845|NP_003836|dual...     51   1e-006
hg18||uc003vve |7|NM_022740|NA|NA|HIPK2|NM_022740|NP_073577|home...     43   4e-004
hg18||uc003vvf |7|AF208291|Q9H2X6|HIPK2_HUMAN|HIPK2|NA|NA|Homeod...     43   4e-004
hg18||uc003vvg |7|AF326592|Q9H2X6-3|Q9H2X6-3|HIPK2|NA|NA|Homeodo...     43   4e-004
hg18||uc001mul |11|NM_005734|Q9H422|HIPK3_HUMAN|HIPK3|NM_005734|...     40   0.002
hg18||uc001mum |11|NM_001048200|Q9H422-2|Q9H422-2|HIPK3|NM_00104...     40   0.002
hg18||uc003ckw |3|AK000581|NA|NA|ULK4|NA|NA|Homo sapiens cDNA FL...     40   0.003
hg18||uc003ckx |3|BC014794|NA|NA|ULK4|NA|NA|Homo sapiens cDNA FL...     40   0.003
hg18||uc001eel |1|NM_152696|Q86Z02-2|Q86Z02-2|HIPK1|NM_152696|NP...     39   0.004
hg18||uc001eem |1|NM_198268|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|N...     39   0.004
hg18||uc001een |1|AB089957|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP...     39   0.004
hg18||uc001eeo |1|NM_198269|Q86Z02-3|Q86Z02-3|HIPK1|NM_198269|NP...     39   0.004
hg18||uc001eep |1|NM_181358|Q86Z02-4|Q86Z02-4|HIPK1|NM_181358|NP...     39   0.004
hg18||uc001sit |12|NM_001798|P24941|CDK2_HUMAN|CDK2|NM_001798|NP...     39   0.007
hg18||uc002omj |19|NM_004714|Q9Y463|DYR1B_HUMAN|DYRK1B|NM_004714...     37   0.021
hg18||uc003yzj |8|NM_139021|Q8TD08|MK15_HUMAN|MAPK15|NM_139021|N...     36   0.046
hg18||uc002omi |19|NM_006484|Q9Y463-3|Q9Y463-3|DYRK1B|NM_006484|...     35   0.078
hg18||uc002omk |19|NM_006483|Q9Y463-2|Q9Y463-2|DYRK1B|NM_006483|...     35   0.078
hg18||uc003yio |8|AK131363|Q13188|STK3_HUMAN|STK3|NM_006281|NP_0...     33   0.389
hg18||uc003yip |8|NM_006281|Q13188|STK3_HUMAN|STK3|NM_006281|NP_...     33   0.389
hg18||uc003mbo |5|NM_005990|O94804|STK10_HUMAN|STK10|NM_005990|N...     32   0.865
hg18||uc003olh |6|BX648697|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP_...     32   0.865
hg18||uc003oli |6|AJ318054|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP_...     32   0.865
hg18||uc003olj |6|NM_003137|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP...     32   0.865
hg18||uc002grf |17|NM_020201|Q9NPB1|NT5M_HUMAN|NT5M|NM_020201|NP...     31   1.130
hg18||uc001kxo |10|NM_014720|Q9H2G2|SLK_HUMAN|SLK|NM_014720|NP_0...     31   1.476
hg18||uc001kxp |10|BC111565|Q9H2G2-2|Q9H2G2-2|SLK|NM_014720|NP_0...     31   1.476
hg18||uc002grg |17|DQ323995|Q2I378|Q2I378_HUMAN|NT5M|NM_020201|N...     30   1.928
hg18||uc004dfk |X|AF262404|Q5VT16|Q5VT16_HUMAN|CASK|NM_003688|NP...     30   3.289
hg18||uc004dfl |X|NM_003688|Q59HA0|Q59HA0_HUMAN|CASK|NM_003688|N...     30   3.289
hg18||uc004dfm |X|BC117311|Q17RI4|Q17RI4_HUMAN|CASK|NM_003688|NP...     30   3.289
hg18||uc004dfn |X|AF035582|Q5VT18|Q5VT18_HUMAN|CASK|NM_003688|NP...     30   3.289
hg18||uc002xnb |20|NM_006282|Q13043|STK4_HUMAN|STK4|NM_006282|NP...     29   4.295
hg18||uc004cym |X|NM_003159|O76039|CDKL5_HUMAN|CDKL5|NM_003159|N...     29   5.610
hg18||uc004cyn |X|NM_001037343|O76039|CDKL5_HUMAN|CDKL5|NM_00103...     29   5.610
hg18||uc001isn |10|NM_017433|Q8NEV4|MYO3A_HUMAN|MYO3A|NM_017433|...     28   9.569
hg18||uc001oyh |11|NM_002576|Q13153|PAK1_HUMAN|PAK1|NM_002576|NP...     28   9.569

>hg18||uc001str
        |12|NM_006482|Q9BRB5|Q9BRB5_HUMAN|DYRK2|NM_006482|NP_006473|dual-specif
        icity tyrosine-(Y)-phosphorylation

          Length = 601

 Score =  72 bits (175), Expect = 6e-013
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCP-- 58
           ||||||.. ||  |  |  | .| | .  ..|||| |  ..|||  .   .      |  
Sbjct: 405 MWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRY 464

Query:  59 -----WNRSWKLKTHLRTAGHKLLDSLDDILSAFRTKGCENPDLSLFVDMLKKMLDLDPA 113
                 .    .    |.   ||    .        |||..|   ||.| ||. |. |||
Sbjct: 465 CTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDP---LFLDFLKQCLEWDPA 521

Query: 114 TRITPAQLLQHGFL 127
            |.|| | |.| .|
Sbjct: 522 VRMTPGQALRHPWL 535

>hg18||uc001sts
        |12|NM_003583|Q92630|DYRK2_HUMAN|DYRK2|NM_003583|NP_003574|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 528

 Score =  72 bits (175), Expect = 6e-013
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCP-- 58
           ||||||.. ||  |  |  | .| | .  ..|||| |  ..|||  .   .      |  
Sbjct: 332 MWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRY 391

Query:  59 -----WNRSWKLKTHLRTAGHKLLDSLDDILSAFRTKGCENPDLSLFVDMLKKMLDLDPA 113
                 .    .    |.   ||    .        |||..|   ||.| ||. |. |||
Sbjct: 392 CTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDP---LFLDFLKQCLEWDPA 448

Query: 114 TRITPAQLLQHGFL 127
            |.|| | |.| .|
Sbjct: 449 VRMTPGQALRHPWL 462

>hg18||uc002omi
        |19|NM_006484|Q9Y463-3|Q9Y463-3|DYRK1B|NM_006484|NP_006475|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 601

 Score =  67 bits (162), Expect = 2e-011
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||||||.. |.| |. || |.|| | |  |||.|| ||  |||   |  .||..
Sbjct: 296 MWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFER 349

>hg18||uc002omj
        |19|NM_004714|Q9Y463|DYR1B_HUMAN|DYRK1B|NM_004714|NP_004705|dual-specif
        icity tyrosine-(Y)-phosphorylation

          Length = 629

 Score =  67 bits (162), Expect = 2e-011
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||||||.. |.| |. || |.|| | |  |||.|| ||  |||   |  .||..
Sbjct: 296 MWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFER 349

>hg18||uc002omk
        |19|NM_006483|Q9Y463-2|Q9Y463-2|DYRK1B|NM_006483|NP_006474|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 589

 Score =  67 bits (162), Expect = 2e-011
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||||||.. |.| |. || |.|| | |  |||.|| ||  |||   |  .||..
Sbjct: 296 MWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFER 349

>hg18||uc001hei
        |1|NM_001004023|Q9HBY6|Q9HBY6_HUMAN|DYRK3|NM_001004023|NP_001004023|dua
        l-specificity tyrosine-(Y)-phosphorylation

          Length = 568

 Score =  66 bits (160), Expect = 3e-011
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           .|| ||.. ||  |  || | .| | .  ..|||| || ..|.   .   .      |  
Sbjct: 372 IWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIP-- 429

Query:  61 RSWKLKTHL---------RTAGHKLLDSLDDILSAFRTKGCENPDLSLFVDMLKKMLDLD 111
           |   . |           |.   |              |||..    ||.. ||. |  |
Sbjct: 430 RYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDD---YLFIEFLKRCLHWD 486

Query: 112 PATRITPAQLLQHGFLTNTEVGTTCEEPEVTASKKNGQSLQSQCESTQ 159
           |. |.|||| |.| ...      .   |  |  | .|. . .   . |
Sbjct: 487 PSARLTPAQALRHPWISK-----SVPRPLTTIDKVSGKRVVNPASAFQ 529

>hg18||uc001hej
        |1|NM_003582|Q9HBY7|Q9HBY7_HUMAN|DYRK3|NM_003582|NP_003573|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 588

 Score =  66 bits (160), Expect = 3e-011
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           .|| ||.. ||  |  || | .| | .  ..|||| || ..|.   .   .      |  
Sbjct: 392 IWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIP-- 449

Query:  61 RSWKLKTHL---------RTAGHKLLDSLDDILSAFRTKGCENPDLSLFVDMLKKMLDLD 111
           |   . |           |.   |              |||..    ||.. ||. |  |
Sbjct: 450 RYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDD---YLFIEFLKRCLHWD 506

Query: 112 PATRITPAQLLQHGFLTNTEVGTTCEEPEVTASKKNGQSLQSQCESTQ 159
           |. |.|||| |.| ...      .   |  |  | .|. . .   . |
Sbjct: 507 PSARLTPAQALRHPWISK-----SVPRPLTTIDKVSGKRVVNPASAFQ 549

>hg18||uc002ywi
        |21|NM_101395|Q13627-5|Q13627-5|DYRK1A|NM_101395|NP_567824|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 584

 Score =  65 bits (157), Expect = 7e-011
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.. |.| |. || | || | |  |||.|| ||  .||   |  ..|.|     .
Sbjct: 344 MWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP---D 400

Query:  61 RSWKLK 66
            .| ||
Sbjct: 401 GTWNLK 406

>hg18||uc002ywj
        |21|NM_130436|Q13627-2|Q13627-2|DYRK1A|NM_130436|NP_569120|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 754

 Score =  65 bits (157), Expect = 7e-011
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.. |.| |. || | || | |  |||.|| ||  .||   |  ..|.|     .
Sbjct: 335 MWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP---D 391

Query:  61 RSWKLK 66
            .| ||
Sbjct: 392 GTWNLK 397

>hg18||uc002ywk
        |21|NM_001396|Q13627|DYR1A_HUMAN|DYRK1A|NM_001396|NP_001387|dual-specif
        icity tyrosine-(Y)-phosphorylation

          Length = 763

 Score =  65 bits (157), Expect = 7e-011
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.. |.| |. || | || | |  |||.|| ||  .||   |  ..|.|     .
Sbjct: 344 MWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP---D 400

Query:  61 RSWKLK 66
            .| ||
Sbjct: 401 GTWNLK 406

>hg18||uc002ywl
        |21|NM_130437|Q13627-3|Q13627-3|DYRK1A|NM_130437|NP_569121|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 540

 Score =  65 bits (157), Expect = 7e-011
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.. |.| |. || | || | |  |||.|| ||  .||   |  ..|.|     .
Sbjct: 344 MWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP---D 400

Query:  61 RSWKLK 66
            .| ||
Sbjct: 401 GTWNLK 406

>hg18||uc002ywm
        |21|NM_130438|Q13627-3|Q13627-3|DYRK1A|NM_130438|NP_569122|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 529

 Score =  65 bits (157), Expect = 7e-011
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.. |.| |. || | || | |  |||.|| ||  .||   |  ..|.|     .
Sbjct: 344 MWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLP---D 400

Query:  61 RSWKLK 66
            .| ||
Sbjct: 401 GTWNLK 406

>hg18||uc002onp
        |19|NM_144685|Q8NE63|HIPK4_HUMAN|HIPK4|NM_144685|NP_653286|homeodomain
        interacting protein kinase 4

          Length = 616

 Score =  65 bits (156), Expect = 9e-011
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCP-W 59
           .||||||. |||||  |. |||||| .| | |  | |   .| |  | . .||..  |  
Sbjct: 198 VWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAACKAHHFFKRNPHPDA 257

Query:  60 NRSWKLKT 67
              |.||.
Sbjct: 258 ANPWQLKS 265

>hg18||uc003vve |7|NM_022740|NA|NA|HIPK2|NM_022740|NP_073577|homeodomain
        interacting protein kinase 2

          Length = 815

 Score =  62 bits (149), Expect = 6e-010
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:  1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
          |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct:  1 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPY 60

Query: 61 RSWKLKT 67
            |.|||
Sbjct: 61 PLWRLKT 67

>hg18||uc003vvf
        |7|AF208291|Q9H2X6|HIPK2_HUMAN|HIPK2|NA|NA|Homeodomain-interacting
        protein kinase 2 (EC 2.7.11.1) (hHIPk2)

          Length = 1191

 Score =  62 bits (149), Expect = 6e-010
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct: 377 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPY 436

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 437 PLWRLKT 443

>hg18||uc003vvg
        |7|AF326592|Q9H2X6-3|Q9H2X6-3|HIPK2|NA|NA|Homeodomain-interacting
        protein kinase 2 (EC 2.7.11.1) (hHIPk2)

          Length = 1171

 Score =  62 bits (149), Expect = 6e-010
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct: 384 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPY 443

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 444 PLWRLKT 450

>hg18||uc001eel
        |1|NM_152696|Q86Z02-2|Q86Z02-2|HIPK1|NM_152696|NP_689909|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 1075

 Score =  61 bits (147), Expect = 1e-009
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct: 375 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGY 434

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 435 PLWRLKT 441

>hg18||uc001eem
        |1|NM_198268|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP_938009|homeodomain-i
        nteracting protein kinase 1 isoform

          Length = 1210

 Score =  61 bits (147), Expect = 1e-009
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct: 375 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGY 434

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 435 PLWRLKT 441

>hg18||uc001een
        |1|AB089957|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP_938009|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 1210

 Score =  61 bits (147), Expect = 1e-009
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct: 375 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGY 434

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 435 PLWRLKT 441

>hg18||uc001eeo
        |1|NM_198269|Q86Z02-3|Q86Z02-3|HIPK1|NM_198269|NP_938010|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 836

 Score =  61 bits (147), Expect = 1e-009
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:  1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
          |||||||. || ||  |. | .||| .| | .  | |   .| || || ..| .      
Sbjct:  1 MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGY 60

Query: 61 RSWKLKT 67
            |.|||
Sbjct: 61 PLWRLKT 67

>hg18||uc001mul
        |11|NM_005734|Q9H422|HIPK3_HUMAN|HIPK3|NM_005734|NP_005725|homeodomain
        interacting protein kinase 3 isoform

          Length = 1215

 Score =  61 bits (146), Expect = 1e-009
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. |  ||| .| | .  | |  ..|. | |. ..| |     .
Sbjct: 382 MWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGEQLLNVGTKSTRFFCKETDMSH 441

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 442 SGWRLKT 448

>hg18||uc001mum
        |11|NM_001048200|Q9H422-2|Q9H422-2|HIPK3|NM_001048200|NP_001041665|home
        odomain interacting protein kinase 3 isoform

          Length = 1194

 Score =  61 bits (146), Expect = 1e-009
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           |||||||. || ||  |. |  ||| .| | .  | |  ..|. | |. ..| |     .
Sbjct: 382 MWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGEQLLNVGTKSTRFFCKETDMSH 441

Query:  61 RSWKLKT 67
             |.|||
Sbjct: 442 SGWRLKT 448

>hg18||uc003mvv
        |6|NM_003913|Q5TAY8|Q5TAY8_HUMAN|PRPF4B|NM_003913|NP_003904|serine/thre
        onine-protein kinase PRP4K

          Length = 1007

 Score =  55 bits (132), Expect = 6e-008
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query:    6 CVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPW-----N 60
            | . ||. |  || |     |..  ..| |. ||.|.  |.  .|.| ..|         
Sbjct:  877 CTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDK 936

Query:   61 RSWKLKTHLRTAGHKLLDSLDDILSAFRTKGCENPDLSLFVDMLKKMLDLDPATRITPAQ 120
             . . |  . .  .   | | |..   |    .   .    |.| ..| |||| ||.  |
Sbjct:  937 VTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQ 996

Query:  121 LLQHGFL 127
             ||| |.
Sbjct:  997 ALQHAFI 1003

>hg18||uc001qmx
        |12|NM_003845|Q9NR20|DYRK4_HUMAN|DYRK4|NM_003845|NP_003836|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 520

 Score =  51 bits (121), Expect = 1e-006
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.  ||. |  || | || . .  |.|.|| ||   .    .   .|     | |
Sbjct: 287 MWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKN 346

>hg18||uc001qmy
        |12|AF263541|Q9NR20-2|Q9NR20-2|DYRK4|NM_003845|NP_003836|dual-specifici
        ty tyrosine-(Y)-phosphorylation

          Length = 519

 Score =  51 bits (121), Expect = 1e-006
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           ||||||.  ||. |  || | || . .  |.|.|| ||   .    .   .|     | |
Sbjct: 287 MWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKN 346

>hg18||uc001qmz |12|CR615549|NA|NA|DYRK4|NM_003845|NP_003836|dual-specificity
        tyrosine-(Y)-phosphorylation

          Length = 233

 Score =  51 bits (121), Expect = 1e-006
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query:  1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
          ||||||.  ||. |  || | || . .  |.|.|| ||   .    .   .|     | |
Sbjct:  1 MWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKN 60

>hg18||uc003vve |7|NM_022740|NA|NA|HIPK2|NM_022740|NP_073577|homeodomain
        interacting protein kinase 2

          Length = 815

 Score =  43 bits (99), Expect = 4e-004
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query:  76 LLDSLDDILSAFRTKGCENPDLSL-------FVDMLKKMLDLDPATRITPAQLLQHGFLT 128
           . . |||.     |   |  |. .       |.|.||||| .|   |||| . | | |.|
Sbjct:  86 IFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVT 145

Query: 129 NTEV 132
            | .
Sbjct: 146 MTHL 149

>hg18||uc003vvf
        |7|AF208291|Q9H2X6|HIPK2_HUMAN|HIPK2|NA|NA|Homeodomain-interacting
        protein kinase 2 (EC 2.7.11.1) (hHIPk2)

          Length = 1191

 Score =  43 bits (99), Expect = 4e-004
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query:  76 LLDSLDDILSAFRTKGCENPDLSL-------FVDMLKKMLDLDPATRITPAQLLQHGFLT 128
           . . |||.     |   |  |. .       |.|.||||| .|   |||| . | | |.|
Sbjct: 462 IFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVT 521

Query: 129 NTEV 132
            | .
Sbjct: 522 MTHL 525

>hg18||uc003vvg
        |7|AF326592|Q9H2X6-3|Q9H2X6-3|HIPK2|NA|NA|Homeodomain-interacting
        protein kinase 2 (EC 2.7.11.1) (hHIPk2)

          Length = 1171

 Score =  43 bits (99), Expect = 4e-004
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query:  76 LLDSLDDILSAFRTKGCENPDLSL-------FVDMLKKMLDLDPATRITPAQLLQHGFLT 128
           . . |||.     |   |  |. .       |.|.||||| .|   |||| . | | |.|
Sbjct: 469 IFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVT 528

Query: 129 NTEV 132
            | .
Sbjct: 529 MTHL 532

>hg18||uc001mul
        |11|NM_005734|Q9H422|HIPK3_HUMAN|HIPK3|NM_005734|NP_005725|homeodomain
        interacting protein kinase 3 isoform

          Length = 1215

 Score =  40 bits (92), Expect = 0.002
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 22/108 (20%)

Query:  76 LLDSLDDILSAFRTKGCENPDLSL-------FVDMLKKMLDLDPATRITPAQLLQHGFLT 128
           . .||||.         |  ||         || .||||| .|   |||||. | | |. 
Sbjct: 467 IFNSLDDVAHVNTVMDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPAETLNHPFVN 526

Query: 129 ---------NTEVGTTCEEPEVTASKKNGQSLQSQCESTQHNQASQLK 167
                    .  | .     ..  |  |       |..  ||. | |.
Sbjct: 527 MKHLLDFPHSNHVKSCFHIMDICKSHLN------SCDTNNHNKTSLLR 568

>hg18||uc001mum
        |11|NM_001048200|Q9H422-2|Q9H422-2|HIPK3|NM_001048200|NP_001041665|home
        odomain interacting protein kinase 3 isoform

          Length = 1194

 Score =  40 bits (92), Expect = 0.002
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 22/108 (20%)

Query:  76 LLDSLDDILSAFRTKGCENPDLSL-------FVDMLKKMLDLDPATRITPAQLLQHGFLT 128
           . .||||.         |  ||         || .||||| .|   |||||. | | |. 
Sbjct: 467 IFNSLDDVAHVNTVMDLEGSDLLAEKADRREFVSLLKKMLLIDADLRITPAETLNHPFVN 526

Query: 129 ---------NTEVGTTCEEPEVTASKKNGQSLQSQCESTQHNQASQLK 167
                    .  | .     ..  |  |       |..  ||. | |.
Sbjct: 527 MKHLLDFPHSNHVKSCFHIMDICKSHLN------SCDTNNHNKTSLLR 568

>hg18||uc003ckw |3|AK000581|NA|NA|ULK4|NA|NA|Homo sapiens cDNA FLJ20574 fis,
        clone REC01035

          Length = 732

 Score =  40 bits (91), Expect = 0.003
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 100 FVDMLKKMLDLDPATRITPAQLLQHGFLTNTEVGTTCEE-------PEVTASKKNGQSLQ 152
           |...|  .|  ||  |.|  .|||| |      |   |           |      |  .
Sbjct: 253 FINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQESSVEDLSLSRNTMECSGPQDSK 312

Query: 153 SQCESTQHNQASQLKTGQKRKHDYKDDDPT 182
              ...|  ||   |.||   | .. ..||
Sbjct: 313 ELLQNSQSRQAKGHKSGQPLGHSFRLENPT 342

>hg18||uc003ckx |3|BC014794|NA|NA|ULK4|NA|NA|Homo sapiens cDNA FLJ20574 fis,
        clone REC01035

          Length = 580

 Score =  40 bits (91), Expect = 0.003
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 100 FVDMLKKMLDLDPATRITPAQLLQHGFLTNTEVGTTCEE-------PEVTASKKNGQSLQ 152
           |...|  .|  ||  |.|  .|||| |      |   |           |      |  .
Sbjct: 253 FINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQESSVEDLSLSRNTMECSGPQDSK 312

Query: 153 SQCESTQHNQASQLKTGQKRKHDYKDDDPT 182
              ...|  ||   |.||   | .. ..||
Sbjct: 313 ELLQNSQSRQAKGHKSGQPLGHSFRLENPT 342

>hg18||uc001eel
        |1|NM_152696|Q86Z02-2|Q86Z02-2|HIPK1|NM_152696|NP_689909|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 1075

 Score =  39 bits (90), Expect = 0.004
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query:  93 ENPDLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEV 132
           |  |   ..|.||||| .|   |||| . | | |.| | .
Sbjct: 484 EKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHL 523

>hg18||uc001eem
        |1|NM_198268|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP_938009|homeodomain-i
        nteracting protein kinase 1 isoform

          Length = 1210

 Score =  39 bits (90), Expect = 0.004
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query:  93 ENPDLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEV 132
           |  |   ..|.||||| .|   |||| . | | |.| | .
Sbjct: 484 EKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHL 523

>hg18||uc001een
        |1|AB089957|Q86Z02|HIPK1_HUMAN|HIPK1|NM_198268|NP_938009|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 1210

 Score =  39 bits (90), Expect = 0.004
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query:  93 ENPDLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEV 132
           |  |   ..|.||||| .|   |||| . | | |.| | .
Sbjct: 484 EKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHL 523

>hg18||uc001eeo
        |1|NM_198269|Q86Z02-3|Q86Z02-3|HIPK1|NM_198269|NP_938010|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 836

 Score =  39 bits (90), Expect = 0.004
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query:  93 ENPDLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEV 132
           |  |   ..|.||||| .|   |||| . | | |.| | .
Sbjct: 110 EKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHL 149

>hg18||uc001eep
        |1|NM_181358|Q86Z02-4|Q86Z02-4|HIPK1|NM_181358|NP_852003|homeodomain-in
        teracting protein kinase 1 isoform

          Length = 816

 Score =  39 bits (90), Expect = 0.004
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query:  93 ENPDLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEV 132
           |  |   ..|.||||| .|   |||| . | | |.| | .
Sbjct:  90 EKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHL 129

>hg18||uc001sit
        |12|NM_001798|P24941|CDK2_HUMAN|CDK2|NM_001798|NP_001789|cyclin-depende
        nt kinase 2 isoform 1

          Length = 298

 Score =  39 bits (88), Expect = 0.007
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQPPNRMLDAGIKTNQYFKKSLCPWN 60
           .|||||.  |.     || |..| | .  |   ||  |. ..  |. .   .| |   | 
Sbjct: 186 IWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLG-TPDEVVWPGVTSMPDYKPSFPKWA 244

Query:  61 R 61
           |
Sbjct: 245 R 245

>hg18||uc002omj
        |19|NM_004714|Q9Y463|DYR1B_HUMAN|DYRK1B|NM_004714|NP_004705|dual-specif
        icity tyrosine-(Y)-phosphorylation

          Length = 629

 Score =  37 bits (84), Expect = 0.021
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query:  96 DLSLFVDMLKKMLDLDPATRITPAQLLQHGFLTNTEVGTTCEEPEVTASKKNGQSLQSQC 155
           |   | |.. .||. .|| ||.|   |||||   |    |   |  ...  .   | . |
Sbjct: 400 DYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDT-C 458

Query: 156 EST 158
            |.
Sbjct: 459 PSS 461

>hg18||uc003yzj
        |8|NM_139021|Q8TD08|MK15_HUMAN|MAPK15|NM_139021|NP_620590|mitogen-activ
        ated protein kinase 15

          Length = 544

 Score =  36 bits (81), Expect = 0.046
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query:   1 MWSLGCVVGELHLGDRLFDGNNEYDMMRSIVELLGQP 37
           ||||||..||.  |  || | .    .  |.| .  |
Sbjct: 201 MWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPP 237

>hg18||uc002omi
        |19|NM_006484|Q9Y463-3|Q9Y463-3|DYRK1B|NM_006484|NP_006475|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 601

 Score =  35 bits (79), Expect = 0.078
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 102 DMLKKMLDLDPATRITPAQLLQHGFLTNTEVGTTCEEPEVTASKKNGQSLQSQCEST 158
           |.. .||. .|| ||.|   |||||   |    |   |  ...  .   | . | |.
Sbjct: 378 DLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDT-CPSS 433

>hg18||uc002omk
        |19|NM_006483|Q9Y463-2|Q9Y463-2|DYRK1B|NM_006483|NP_006474|dual-specifi
        city tyrosine-(Y)-phosphorylation

          Length = 589

 Score =  35 bits (79), Expect = 0.078
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 102 DMLKKMLDLDPATRITPAQLLQHGFLTNTEVGTTCEEPEVTASKKNGQSLQSQCEST 158
           |.. .||. .|| ||.|   |||||   |    |   |  ...  .   | . | |.
Sbjct: 366 DLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDT-CPSS 421

>hg18||uc003yio
        |8|AK131363|Q13188|STK3_HUMAN|STK3|NM_006281|NP_006272|serine/threonine
        kinase 3 (STE20 homolog,

          Length = 519

 Score =  33 bits (73), Expect = 0.389
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 100 FVDMLKKMLDLDPATRITPAQLLQHGFLTNTE 131
           | | .|| |  .|  | |  ||||| |. | .
Sbjct: 279 FTDFVKKCLVKNPEQRATATQLLQHPFIKNAK 310

>hg18||uc003yip
        |8|NM_006281|Q13188|STK3_HUMAN|STK3|NM_006281|NP_006272|serine/threonin
        e kinase 3 (STE20 homolog,

          Length = 491

 Score =  33 bits (73), Expect = 0.389
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 100 FVDMLKKMLDLDPATRITPAQLLQHGFLTNTE 131
           | | .|| |  .|  | |  ||||| |. | .
Sbjct: 251 FTDFVKKCLVKNPEQRATATQLLQHPFIKNAK 282

>hg18||uc003mbo
        |5|NM_005990|O94804|STK10_HUMAN|STK10|NM_005990|NP_005981|serine/threon
        ine kinase 10

          Length = 968

 Score =  32 bits (70), Expect = 0.865
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 100 FVDMLKKMLDLDPATRITPAQLLQHGFLTN 129
           | | ||  || .| || . ||||.| |...
Sbjct: 267 FRDFLKIALDKNPETRPSAAQLLEHPFVSS 296

>hg18||uc003olh |6|BX648697|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP_003128|SFRS
        protein kinase 1

          Length = 548

 Score =  32 bits (70), Expect = 0.865
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query:  10 ELHLGDRLFD--GNNEY----DMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||  || ||.     ||    | .  |.||||. | ... ||  . ..| |
Sbjct: 436 ELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTK 486

>hg18||uc003oli |6|AJ318054|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP_003128|SFRS
        protein kinase 1

          Length = 548

 Score =  32 bits (70), Expect = 0.865
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query:  10 ELHLGDRLFD--GNNEY----DMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||  || ||.     ||    | .  |.||||. | ... ||  . ..| |
Sbjct: 436 ELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTK 486

>hg18||uc003olj |6|NM_003137|Q96SB4-2|Q96SB4-2|SRPK1|NM_003137|NP_003128|SFRS
        protein kinase 1

          Length = 655

 Score =  32 bits (70), Expect = 0.865
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query:  10 ELHLGDRLFD--GNNEY----DMMRSIVELLGQPPNRMLDAGIKTNQYFKK 54
           ||  || ||.     ||    | .  |.||||. | ... ||  . ..| |
Sbjct: 543 ELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTK 593

>hg18||uc002grf
        |17|NM_020201|Q9NPB1|NT5M_HUMAN|NT5M|NM_020201|NP_064586|5',3'-nucleoti
        dase, mitochondrial precursor

          Length = 228

 Score =  31 bits (69), Expect = 1.130
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 137 EEPEVTASKKNGQSLQSQCESTQHNQASQLKTGQKRKHDYKDDDPTCHDSKRP 189
           . |..| ..    | .    .  |||  ||.  ..| | . ||     |||||
Sbjct: 176 DRPDITGAEPT-PSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP 227

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,631,354
Number of Sequences: 45480
Number of Extensions: 191631354
Number of Successful Extensions: 11116211
Number of sequences better than 0.0: 0
BLASTP 7.6.0