BLASTP 7.6.0


Query=fugu4_747620 |jgi|Takru4|747620|fgh5_pg.C_scaffold_7088000002
        (172 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003lwh |5|NM_138379|Q96H15|TIMD4_HUMAN|TIMD4|NM_138379|N...     90   1e-018
hg18||uc003lwi |5|BC013325|Q96D42|TIMD1_HUMAN|HAVCR1|NM_012206|N...     81   5e-016
hg18||uc003lwj |5|NM_012206|Q96D42|TIMD1_HUMAN|HAVCR1|NM_012206|...     81   5e-016
hg18||uc003lwk |5|NM_032782|Q8TDQ0|TIMD3_HUMAN|HAVCR2|NM_032782|...     75   4e-014
hg18||uc003lwl |5|BC020843|Q8TDQ0-2|Q8TDQ0-2|HAVCR2|NM_032782|NP...     75   4e-014
hg18||uc001psm |11|NM_198275|Q6UWV2|Q6UWV2_HUMAN|LOC196264|NM_19...     52   4e-007
hg18||uc002jkv |17|NM_007261|Q9UGN4|CM35H_HUMAN|CD300A|NM_007261...     33   0.115
hg18||uc002jky |17|NM_006678|Q08708|CM35A_HUMAN|CD300C|NM_006678...     33   0.115
hg18||uc002lbl |18|NM_213602|Q6ZMC9|Q6ZMC9_HUMAN|CD33L3|NM_21360...     33   0.150
hg18||uc003mmp |5|NM_001040462|Q6UX41|BTNL8_HUMAN|BTNL8|NM_00104...     33   0.150
hg18||uc003mmq |5|NM_024850|Q6UX41-2|Q6UX41-2|BTNL8|NM_024850|NP...     33   0.150
hg18||uc003msu |5_random|NM_001040462|Q6UX41|BTNL8_HUMAN|BTNL8|N...     33   0.150
hg18||uc003msv |5_random|AK025111|Q6UX41-2|Q6UX41-2|BTNL8|NM_024...     33   0.150
hg18||uc001sqg |12|NM_015433|Q96AZ1|Q96AZ1_HUMAN|FAM119B|NM_0154...     32   0.435
hg18||uc001hsn |1|NM_052843|Q5VST9-3|Q5VST9-3|OBSCN|NM_052843|NP...     30   1.654
hg18||uc003dpm |3|NM_020872|Q9P232|CNTN3_HUMAN|CNTN3|NM_020872|N...     30   1.654
hg18||uc001qqs |12|BC052589|Q7Z643|Q7Z643_HUMAN|LAG3|NM_002286|N...     29   2.160
hg18||uc001qqt |12|NM_002286|P18627|LAG3_HUMAN|LAG3|NM_002286|NP...     29   2.160
hg18||uc001qqu |12|BC037962|NA|NA|LAG3|NA|NA|Homo sapiens lympho...     29   2.160
hg18||uc002pwt |19|NM_014442|Q9NYZ4|SIGL8_HUMAN|SIGLEC8|NM_01444...     29   2.160
hg18||uc002wfk |20|BC131747|Q5TFQ9|Q5TFQ9_HUMAN|SIRPB1|NA|NA|OTT...     29   2.160
hg18||uc001frm |1|NM_018240|Q5W0F9|Q5W0F9_HUMAN|KIRREL|NM_018240...     29   2.821
hg18||uc001frn |1|BC109193|Q96J84|KIRR1_HUMAN|KIRREL|NM_018240|N...     29   2.821
hg18||uc001fro |1|AK022708|Q5W0G0|Q5W0G0_HUMAN|KIRREL|NM_018240|...     29   2.821
hg18||uc002ozt |19|NM_001013257|P50895|LU_HUMAN|BCAM|NM_00101325...     29   2.821
hg18||uc002ozu |19|NM_005581|P50895|LU_HUMAN|BCAM|NM_005581|NP_0...     29   2.821
hg18||uc002pwx |19|NM_053003|Q96PQ1|SIG12_HUMAN|SIGLEC12|NM_0530...     29   2.821
hg18||uc002djg |16|NM_005849|O95976|O95976_HUMAN|IGSF6|NM_005849...     28   3.684
hg18||uc002wfl |20|BX537992|Q5SXI1|Q5SXI1_HUMAN|SIRPB1|NA|NA|OTT...     28   3.684
hg18||uc001lfh |10|NM_022970|P21802-18|P21802-18|FGFR2|NM_022970...     28   6.285
hg18||uc001lfm |10|M35718|P21802-4|P21802-4|FGFR2|NM_022970|NP_0...     28   6.285
hg18||uc001lfo |10|U11814|P21802-19|P21802-19|FGFR2|NM_022970|NP...     28   6.285
hg18||uc002umr |2|NM_133378|NA|NA|TTN|NM_133378|NP_596869|titin ...     28   6.285
hg18||uc002umz |2|X90569|NA|NA|TTN|NA|NA|Homo sapiens titin (TTN...     28   6.285
hg18||uc002wfq |20|NM_001040022|P78324|SHPS1_HUMAN|SIRPA|NM_0010...     28   6.285
hg18||uc002wfr |20|NM_080792|P78324|SHPS1_HUMAN|SIRPA|NM_080792|...     28   6.285
hg18||uc002wfs |20|NM_001040023|P78324|SHPS1_HUMAN|SIRPA|NM_0010...     28   6.285
hg18||uc002wft |20|BC033092|P78324-2|P78324-2|SIRPA|NM_080792|NP...     28   6.285
hg18||uc002wfj |20|NM_006065|O00241|SIRB1_HUMAN|SIRPB1|NM_006065...     27   8.208

>hg18||uc003lwh |5|NM_138379|Q96H15|TIMD4_HUMAN|TIMD4|NM_138379|NP_612388|T-cell
        immunoglobulin and mucin domain

          Length = 378

 Score =  90 bits (221), Expect = 1e-018
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 5/110 (4%)

Query:  21 VNGYVGQNVTLQCSYKSQS--EVAACWNRDWFSGLSCRNSQLISSDGHKVIEAPRASSRY 78
           |   .|  ||| | | | |    . || .|      |. . || .|| .|    | |..|
Sbjct:  28 VTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEA-LIRTDGMRV--TSRKSAKY 84

Query:  79 QLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVVKKA 128
           .| | . .||||||||| .|.|.| | ||.|.|||||| |  . | ...|
Sbjct:  85 RLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRA 134

>hg18||uc003lwi
        |5|BC013325|Q96D42|TIMD1_HUMAN|HAVCR1|NM_012206|NP_036338|hepatitis A
        virus cellular receptor 1

          Length = 364

 Score =  81 bits (199), Expect = 5e-016
 Identities = 46/108 (42%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query:  18 SRQVNGYVGQNVTLQCSYKSQSEVAACWNRDWFSGLSCRNSQLISSDGHKVIEAPRASSR 77
           | .| |  | .||| | | | .  . ||||   |  .|.|  . ..  |      |  .|
Sbjct:  21 SVKVGGEAGPSVTLPCHY-SGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTY---RKDTR 76

Query:  78 YQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVV 125
           |.||| | . |||||| |   .|.| | ||||  ||||| |  ..| .
Sbjct:  77 YKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEI 124

>hg18||uc003lwj
        |5|NM_012206|Q96D42|TIMD1_HUMAN|HAVCR1|NM_012206|NP_036338|hepatitis A
        virus cellular receptor 1

          Length = 359

 Score =  81 bits (199), Expect = 5e-016
 Identities = 46/108 (42%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query:  18 SRQVNGYVGQNVTLQCSYKSQSEVAACWNRDWFSGLSCRNSQLISSDGHKVIEAPRASSR 77
           | .| |  | .||| | | | .  . ||||   |  .|.|  . ..  |      |  .|
Sbjct:  21 SVKVGGEAGPSVTLPCHY-SGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTY---RKDTR 76

Query:  78 YQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVV 125
           |.||| | . |||||| |   .|.| | ||||  ||||| |  ..| .
Sbjct:  77 YKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEI 124

>hg18||uc003lwk |5|NM_032782|Q8TDQ0|TIMD3_HUMAN|HAVCR2|NM_032782|NP_116171|T
        cell immunoglobulin mucin 3

          Length = 301

 Score =  75 bits (182), Expect = 4e-014
 Identities = 46/117 (39%), Positives = 61/117 (52%), Gaps = 7/117 (5%)

Query:  16 STSRQVNGYVGQNVTLQCSYKSQSE---VAACWNRDWFSGLSCRNSQLISSDGHKVIEAP 72
           |.  .    ||||  | | |   .    |  || .       | |  | . .     .  
Sbjct:  21 SSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDER----DVN 76

Query:  73 RASSRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVVKKAE 129
             .||| | |   |||||||| |.| ||.| | ||..|||  ||||  . ||.| |.
Sbjct:  77 YWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAK 133

>hg18||uc003lwl |5|BC020843|Q8TDQ0-2|Q8TDQ0-2|HAVCR2|NM_032782|NP_116171|T cell
        immunoglobulin mucin 3

          Length = 142

 Score =  75 bits (182), Expect = 4e-014
 Identities = 46/117 (39%), Positives = 60/117 (51%), Gaps = 7/117 (5%)

Query:  16 STSRQVNGYVGQNVTLQCSYKSQSE---VAACWNRDWFSGLSCRNSQLISSDGHKVIEAP 72
           |.  .    ||||  | | |   .    |  || .       | |  | . .     .  
Sbjct:  21 SSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDER----DVN 76

Query:  73 RASSRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVVKKAE 129
             .||| | |   |||||||| |.| ||.| | ||..|||  ||||  . ||.|  |
Sbjct:  77 YWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGE 133

>hg18||uc001psm
        |11|NM_198275|Q6UWV2|Q6UWV2_HUMAN|LOC196264|NM_198275|NP_938016|hypothe
        tical protein LOC196264

          Length = 235

 Score =  52 bits (122), Expect = 4e-007
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query:  14 ECSTSRQVNGYVGQNVTLQCSYKSQSEVAACWNRDWFSGLSCRNSQLISSDGHKVIEAPR 73
           |      | ||||. . |.|..|| |.|      || .     .|  .|   ..  . | 
Sbjct:  33 EIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDW-TYRPPSSSHTVSIFHYQSFQYPT 91

Query:  74 AS----SRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIP 111
            .     |   .| . ||| |..| | |  | ||. | |. |
Sbjct:  92 TAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNP 133

>hg18||uc002jkv
        |17|NM_007261|Q9UGN4|CM35H_HUMAN|CD300A|NM_007261|NP_009192|leukocyte
        membrane antigen

          Length = 299

 Score =  33 bits (75), Expect = 0.115
 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query:  90 SLTILNLTEADAGTYGCRVEIPGWFND 116
           ..|. |||| ||||| | |. | |  |
Sbjct:  87 TVTLENLTEEDAGTYWCGVDTP-WLRD 112

>hg18||uc002jky
        |17|NM_006678|Q08708|CM35A_HUMAN|CD300C|NM_006678|NP_006669|CD300C
        antigen

          Length = 224

 Score =  33 bits (75), Expect = 0.115
 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query:  90 SLTILNLTEADAGTYGCRVEIPGWFND 116
           ..|. |||| ||||| | |. | |  |
Sbjct:  94 TVTLENLTEEDAGTYWCGVDTP-WLRD 119

>hg18||uc002lbl
        |18|NM_213602|Q6ZMC9|Q6ZMC9_HUMAN|CD33L3|NM_213602|NP_998767|CD33
        molecule-like 3

          Length = 328

 Score =  33 bits (74), Expect = 0.150
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query:  77 RYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFND---EKHYITLVVKKA 128
           |..|||   . |.|| .  |  ||   | ||||  |  .|    .| . | |  |
Sbjct: 113 RFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAA 167

>hg18||uc003mmp
        |5|NM_001040462|Q6UX41|BTNL8_HUMAN|BTNL8|NM_001040462|NP_001035552|buty
        rophilin-like 8 long form

          Length = 500

 Score =  33 bits (74), Expect = 0.150
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query:  69 IEAPRASSRYQLL-GPLDKGDVSLTILNLTEADAGTYGCRVEIPGWF 114
           .. |.   | .|.   . .| .|| . |.|  ||| ||||.    ..
Sbjct:  76 MQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYY 122

>hg18||uc003mmq
        |5|NM_024850|Q6UX41-2|Q6UX41-2|BTNL8|NM_024850|NP_079126|butyrophilin-l
        ike 8 short form

          Length = 347

 Score =  33 bits (74), Expect = 0.150
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query:  69 IEAPRASSRYQLL-GPLDKGDVSLTILNLTEADAGTYGCRVEIPGWF 114
           .. |.   | .|.   . .| .|| . |.|  ||| ||||.    ..
Sbjct:  76 MQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYY 122

>hg18||uc003msu
        |5_random|NM_001040462|Q6UX41|BTNL8_HUMAN|BTNL8|NM_001040462|NP_0010355
        52|butyrophilin-like 8 long form

          Length = 500

 Score =  33 bits (74), Expect = 0.150
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query:  69 IEAPRASSRYQLL-GPLDKGDVSLTILNLTEADAGTYGCRVEIPGWF 114
           .. |.   | .|.   . .| .|| . |.|  ||| ||||.    ..
Sbjct:  76 MQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYY 122

>hg18||uc003msv
        |5_random|AK025111|Q6UX41-2|Q6UX41-2|BTNL8|NM_024850|NP_079126|butyroph
        ilin-like 8 short form

          Length = 347

 Score =  33 bits (74), Expect = 0.150
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query:  69 IEAPRASSRYQLL-GPLDKGDVSLTILNLTEADAGTYGCRVEIPGWF 114
           .. |.   | .|.   . .| .|| . |.|  ||| ||||.    ..
Sbjct:  76 MQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYY 122

>hg18||uc001sqg
        |12|NM_015433|Q96AZ1|Q96AZ1_HUMAN|FAM119B|NM_015433|NP_056248|hypotheti
        cal protein LOC25895 isoform a

          Length = 226

 Score =  32 bits (70), Expect = 0.435
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query:  24 YVGQNVTLQCSYKSQSEVAACWNRDWFSGLSCRN---SQLISSDGHKVIEAPRASSRYQL 80
           . |  .|.  .. |.  |||   | | . ||  |   || .   | ||||    .    .
Sbjct:  35 FCGHVLTITQNFGSRLGVAA---RVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGI 91

Query:  81 LGPLDKGDVSLTILNL 96
           |  |  |||..| | |
Sbjct:  92 LAALQGGDVTITDLPL 107

>hg18||uc001hsn
        |1|NM_052843|Q5VST9-3|Q5VST9-3|OBSCN|NM_052843|NP_443075|obscurin,
        cytoskeletal calmodulin and

          Length = 6620

 Score =  30 bits (65), Expect = 1.654
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query:   77 RYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEIPGWFNDEKHYITLVVKKAE 129
            |.  .  |  |  || |  |  |||| | |.|     |    |   .||  .|
Sbjct: 4942 RHHHIDQLGDGTCSLLITGLDRADAGCYTCQVS--NKFGQVTHSACVVVSGSE 4992

>hg18||uc003dpm
        |3|NM_020872|Q9P232|CNTN3_HUMAN|CNTN3|NM_020872|NP_065923|contactin 3

          Length = 1028

 Score =  30 bits (65), Expect = 1.654
 Identities = 13/22 (59%), Positives = 15/22 (68%)

Query:  88 DVSLTILNLTEADAGTYGCRVE 109
           |  | | |.|.|||||| |  |
Sbjct: 461 DGGLKIANVTKADAGTYTCMAE 482

>hg18||uc001qqs
        |12|BC052589|Q7Z643|Q7Z643_HUMAN|LAG3|NM_002286|NP_002277|lymphocyte-ac
        tivation protein 3 precursor

          Length = 360

 Score =  29 bits (64), Expect = 2.160
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query:  52 GLSCRNSQLISSDGHKVIEAPRASSRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEI 110
           || ||    . .      .         ||   | || .| . ....| |||| | . .
Sbjct: 279 GLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHL 337

>hg18||uc001qqt
        |12|NM_002286|P18627|LAG3_HUMAN|LAG3|NM_002286|NP_002277|lymphocyte-act
        ivation protein 3 precursor

          Length = 525

 Score =  29 bits (64), Expect = 2.160
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query:  52 GLSCRNSQLISSDGHKVIEAPRASSRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEI 110
           || ||    . .      .         ||   | || .| . ....| |||| | . .
Sbjct: 279 GLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHL 337

>hg18||uc001qqu |12|BC037962|NA|NA|LAG3|NA|NA|Homo sapiens lymphocyte-activation
        gene 3, mRNA (cDNA clone IMAGE:5767130), with apparent retained intron

          Length = 336

 Score =  29 bits (64), Expect = 2.160
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query:  52 GLSCRNSQLISSDGHKVIEAPRASSRYQLLGPLDKGDVSLTILNLTEADAGTYGCRVEI 110
           || ||    . .      .         ||   | || .| . ....| |||| | . .
Sbjct: 109 GLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHL 167

>hg18||uc002pwt
        |19|NM_014442|Q9NYZ4|SIGL8_HUMAN|SIGLEC8|NM_014442|NP_055257|sialic
        acid binding Ig-like lectin 8

          Length = 499

 Score =  29 bits (64), Expect = 2.160
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query:  77 RYQLLGPLDKGDVSLTILNLTEADAGTYGCRVE 109
           |.|||| .   | ||.| .  . | |.|  |.|
Sbjct:  95 RFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLE 127

>hg18||uc002wfk
        |20|BC131747|Q5TFQ9|Q5TFQ9_HUMAN|SIRPB1|NA|NA|OTTHUMP00000029993

          Length = 181

 Score =  29 bits (64), Expect = 2.160
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |..| |.| |||||| |
Sbjct: 102 DFSISISNITPADAGTYYC 120

>hg18||uc001frm |1|NM_018240|Q5W0F9|Q5W0F9_HUMAN|KIRREL|NM_018240|NP_060710|kin
        of IRRE like

          Length = 593

 Score =  29 bits (63), Expect = 2.821
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query:  91 LTILNLTEADAGTYGCRVEIP 111
           | . ..|.|||||| ||  .|
Sbjct: 192 LLLKSVTQADAGTYTCRAIVP 212

>hg18||uc001frn |1|BC109193|Q96J84|KIRR1_HUMAN|KIRREL|NM_018240|NP_060710|kin of
        IRRE like

          Length = 757

 Score =  29 bits (63), Expect = 2.821
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query:  91 LTILNLTEADAGTYGCRVEIP 111
           | . ..|.|||||| ||  .|
Sbjct: 356 LLLKSVTQADAGTYTCRAIVP 376

>hg18||uc001fro |1|AK022708|Q5W0G0|Q5W0G0_HUMAN|KIRREL|NM_018240|NP_060710|kin
        of IRRE like

          Length = 571

 Score =  29 bits (63), Expect = 2.821
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query:  91 LTILNLTEADAGTYGCRVEIP 111
           | . ..|.|||||| ||  .|
Sbjct: 170 LLLKSVTQADAGTYTCRAIVP 190

>hg18||uc002ozt
        |19|NM_001013257|P50895|LU_HUMAN|BCAM|NM_001013257|NP_001013275|basal
        cell adhesion molecule isoform 2

          Length = 588

 Score =  29 bits (63), Expect = 2.821
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query:  90 SLTILNLTEADAGTYGCRVE 109
           .||.  .|   .||||||||
Sbjct: 321 NLTLEGVTRGQSGTYGCRVE 340

>hg18||uc002ozu |19|NM_005581|P50895|LU_HUMAN|BCAM|NM_005581|NP_005572|basal
        cell adhesion molecule isoform 1

          Length = 628

 Score =  29 bits (63), Expect = 2.821
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query:  90 SLTILNLTEADAGTYGCRVE 109
           .||.  .|   .||||||||
Sbjct: 321 NLTLEGVTRGQSGTYGCRVE 340

>hg18||uc002pwx
        |19|NM_053003|Q96PQ1|SIG12_HUMAN|SIGLEC12|NM_053003|NP_443729|sialic
        acid binding immunoglobulin-like

          Length = 595

 Score =  29 bits (63), Expect = 2.821
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query:  77 RYQLLGPLDKGDVSLTILNLTEADAGTYGCRVE 109
           |. |||     | .|.| .  |.|||||   ||
Sbjct:  92 RFHLLGDPQNKDCTLSIRDTRESDAGTYVFCVE 124

>hg18||uc002djg
        |16|NM_005849|O95976|O95976_HUMAN|IGSF6|NM_005849|NP_005840|immunoglobu
        lin superfamily, member 6

          Length = 241

 Score =  28 bits (62), Expect = 3.684
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 12/91 (13%)

Query:  24 YVGQNVTLQCSYKS---QSEVAACWNRDWFSGLSCRNSQLISSDGHKVIEAPRASSRYQL 80
           |  . ||..|.. .    ||   |    ||        . .  || |       . .. .
Sbjct:  42 YTHEAVTIKCTFSATGCPSEQPTCL---WFR-YGAHQPENLCLDGCK-----SEADKFTV 92

Query:  81 LGPLDKGDVSLTILNLTEADAGTYGCRVEIP 111
              | .  ||||.  .|  |.  | | .  |
Sbjct:  93 REALKENQVSLTVNRVTSNDSAIYICGIAFP 123

>hg18||uc002wfl
        |20|BX537992|Q5SXI1|Q5SXI1_HUMAN|SIRPB1|NA|NA|OTTHUMP00000029994

          Length = 398

 Score =  28 bits (62), Expect = 3.684
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |. | |.| |||||| |
Sbjct: 102 DFSIRISNITPADAGTYYC 120

>hg18||uc001lfh
        |10|NM_022970|P21802-18|P21802-18|FGFR2|NM_022970|NP_075259|fibroblast
        growth factor receptor 2 isoform 2

          Length = 822

 Score =  28 bits (60), Expect = 6.285
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query:  91 LTILNLTEADAGTYGCRV 108
           | . |.|||||| | |.|
Sbjct: 325 LALFNVTEADAGEYICKV 342

>hg18||uc001lfm
        |10|M35718|P21802-4|P21802-4|FGFR2|NM_022970|NP_075259|fibroblast
        growth factor receptor 2 isoform 2

          Length = 696

 Score =  28 bits (60), Expect = 6.285
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query:  91 LTILNLTEADAGTYGCRV 108
           | . |.|||||| | |.|
Sbjct: 255 LALFNVTEADAGEYICKV 272

>hg18||uc001lfo
        |10|U11814|P21802-19|P21802-19|FGFR2|NM_022970|NP_075259|fibroblast
        growth factor receptor 2 isoform 2

          Length = 385

 Score =  28 bits (60), Expect = 6.285
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query:  91 LTILNLTEADAGTYGCRV 108
           | . |.|||||| | |.|
Sbjct: 344 LALFNVTEADAGEYICKV 361

>hg18||uc002umr |2|NM_133378|NA|NA|TTN|NM_133378|NP_596869|titin isoform N2-A

          Length = 33423

 Score =  28 bits (60), Expect = 6.285
 Identities = 13/20 (65%)

Query:   89 VSLTILNLTEADAGTYGCRV 108
            ||| ||    |||| | |||
Sbjct: 4448 VSLQILKFVAADAGEYQCRV 4467

>hg18||uc002umz |2|X90569|NA|NA|TTN|NA|NA|Homo sapiens titin (TTN) mRNA, partial
        cds

          Length = 7241

 Score =  28 bits (60), Expect = 6.285
 Identities = 13/20 (65%)

Query:   89 VSLTILNLTEADAGTYGCRV 108
            ||| ||    |||| | |||
Sbjct: 1109 VSLQILKFVAADAGEYQCRV 1128

>hg18||uc002wfq
        |20|NM_001040022|P78324|SHPS1_HUMAN|SIRPA|NM_001040022|NP_001035111|sig
        nal-regulatory protein alpha precursor

          Length = 504

 Score =  28 bits (60), Expect = 6.285
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |. | |.| |||||| |
Sbjct: 103 DFSIRIGNITPADAGTYYC 121

>hg18||uc002wfr
        |20|NM_080792|P78324|SHPS1_HUMAN|SIRPA|NM_080792|NP_542970|signal-regul
        atory protein alpha precursor

          Length = 504

 Score =  28 bits (60), Expect = 6.285
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |. | |.| |||||| |
Sbjct: 103 DFSIRIGNITPADAGTYYC 121

>hg18||uc002wfs
        |20|NM_001040023|P78324|SHPS1_HUMAN|SIRPA|NM_001040023|NP_001035112|sig
        nal-regulatory protein alpha precursor

          Length = 504

 Score =  28 bits (60), Expect = 6.285
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |. | |.| |||||| |
Sbjct: 103 DFSIRIGNITPADAGTYYC 121

>hg18||uc002wft
        |20|BC033092|P78324-2|P78324-2|SIRPA|NM_080792|NP_542970|signal-regulat
        ory protein alpha precursor

          Length = 508

 Score =  28 bits (60), Expect = 6.285
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query:  88 DVSLTILNLTEADAGTYGC 106
           | |. | |.| |||||| |
Sbjct: 103 DFSIRIGNITPADAGTYYC 121

>hg18||uc002wfj
        |20|NM_006065|O00241|SIRB1_HUMAN|SIRPB1|NM_006065|NP_006056|signal-regu
        latory protein beta 1 precursor

          Length = 398

 Score =  27 bits (59), Expect = 8.208
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query:  90 SLTILNLTEADAGTYGC 106
           |..| |.| |||||| |
Sbjct: 104 SISISNITPADAGTYYC 120

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,540,127
Number of Sequences: 45480
Number of Extensions: 192540127
Number of Successful Extensions: 11130575
Number of sequences better than 0.0: 0
BLASTP 7.6.0