BLASTP 7.6.0


Query=fugu4_747613 |jgi|Takru4|747613|fgh5_pg.C_scaffold_7002000001
        (149 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD...     50   1e-006
hg18||uc003dtm |3|NM_182909|Q6KFX7|Q6KFX7_HUMAN|FILIP1L|NM_18290...     30   0.935
hg18||uc003dto |3|NM_001042459|Q6KFX6|Q6KFX6_HUMAN|FILIP1L|NM_00...     30   0.935
hg18||uc001ove |11|NM_198519|Q8TB74|Q8TB74_HUMAN|MGC12965|NM_198...     29   1.596
hg18||uc002cwd |16|NM_016069|Q9Y3D7|TIM16_HUMAN|Magmas|NM_016069...     28   4.643
hg18||uc002cwf |16|BC032732|NA|NA|Magmas|NA|NA|Homo sapiens CGI-...     28   4.643

>hg18||uc002cvo |16|NM_178844|NA|NA|NLRC3|NM_178844|NP_849172|NOD3 protein

          Length = 1065

 Score =  50 bits (117), Expect = 1e-006
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query:  67 SINIFHCLMEMKDQSVHQEIQEFLKSGEISERELSEIHCSALAYLLQMSEEVLDELDLRL 126
           .||. ||| |..   . . ..| ..|| .. |     | .|||||||.|.    | .| |
Sbjct: 564 AINVLHCLHELQHTELARSVEEAMESGALA-RLTGPAHRAALAYLLQVSDACAQEANLSL 622

Query: 127 YNTSDEGRRRLIPAVRNCRKV 147
            . |    . |.| .  |||.
Sbjct: 623 -SLSQGVLQSLLPQLLYCRKL 642

>hg18||uc003dtm
        |3|NM_182909|Q6KFX7|Q6KFX7_HUMAN|FILIP1L|NM_182909|NP_878913|downregula
        ted in ovarian cancer 1 isoform 1

          Length = 1135

 Score =  30 bits (66), Expect = 0.935
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query:  27 ESNQRILGGLLDQRNIHPETIQKVLNNLKEVNSYGISPDTSINIFHCLMEMKDQSVHQEI 86
           || .|||| ||       .|| ..    ..   |    |     | ||.| . . . . |
Sbjct: 152 ESYRRILGQLLVAEKSRRQTILELEEEKRKHKEYMEKSDE----FICLLEQECERLKKLI 207

Query:  87 QEFLKSGEISERE 99
            . .|| |  |.|
Sbjct: 208 DQEIKSQEEKEQE 220

>hg18||uc003dto
        |3|NM_001042459|Q6KFX6|Q6KFX6_HUMAN|FILIP1L|NM_001042459|NP_001035924|d
        ownregulated in ovarian cancer 1 isoform 3

          Length = 1133

 Score =  30 bits (66), Expect = 0.935
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query:  27 ESNQRILGGLLDQRNIHPETIQKVLNNLKEVNSYGISPDTSINIFHCLMEMKDQSVHQEI 86
           || .|||| ||       .|| ..    ..   |    |     | ||.| . . . . |
Sbjct: 152 ESYRRILGQLLVAEKSRRQTILELEEEKRKHKEYMEKSDE----FICLLEQECERLKKLI 207

Query:  87 QEFLKSGEISERE 99
            . .|| |  |.|
Sbjct: 208 DQEIKSQEEKEQE 220

>hg18||uc001ove
        |11|NM_198519|Q8TB74|Q8TB74_HUMAN|MGC12965|NM_198519|NP_940921|hypothet
        ical protein LOC374408

          Length = 298

 Score =  29 bits (64), Expect = 1.596
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query:  23 GLSLESNQRILGGLLD-QRNIHPETIQKV 50
           | |. | ..|.  ||   .||||||. |.
Sbjct: 133 GFSMSSEKKIMSDLLTYTKNIHPETVSKL 161

>hg18||uc002cwd
        |16|NM_016069|Q9Y3D7|TIM16_HUMAN|Magmas|NM_016069|NP_057153|mitochondri
        a-associated granulocyte macrophage

          Length = 125

 Score =  28 bits (60), Expect = 4.643
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query:  8 KSKNGHLDLFVRFLHGLSLESNQRILGGLLDQRNIHPETIQKVLNNLKEVNSYGI 62
          . . ||       | ||||.  |.|    |.   . || .||   .| .||   .
Sbjct: 38 RGRAGHRSAAASNLSGLSLQEAQQI----LNVSKLSPEEVQKNYEHLFKVNDKSV 88

>hg18||uc002cwf |16|BC032732|NA|NA|Magmas|NA|NA|Homo sapiens CGI-136 protein
        mRNA, complete cds

          Length = 1048

 Score =  28 bits (60), Expect = 4.643
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query:    8 KSKNGHLDLFVRFLHGLSLESNQRILGGLLDQRNIHPETIQKVLNNLKEVNSYGI 62
            . . ||       | ||||.  |.|    |.   . || .||   .| .||   .
Sbjct:  961 RGRAGHRSAAASNLSGLSLQEAQQI----LNVSKLSPEEVQKNYEHLFKVNDKSV 1011

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,995,008
Number of Sequences: 45480
Number of Extensions: 189995008
Number of Successful Extensions: 11053239
Number of sequences better than 0.0: 0
BLASTP 7.6.0