BLASTP 7.6.0


Query=fugu4_747606 |jgi|Takru4|747606|fgh5_pg.C_scaffold_6965000001
        (171 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001zwx |15|NM_000138|P35555|FBN1_HUMAN|FBN1|NM_000138|NP...    148   5e-036
hg18||uc002mjf |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP...    147   9e-036
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...    144   6e-035
hg18||uc002mjf |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP...    136   2e-032
hg18||uc001grq |1|NM_031935|Q96RW7|HMCN1_HUMAN|HMCN1|NM_031935|N...    133   1e-031
hg18||uc001grs |1|AL833232|Q69YJ3|Q69YJ3_HUMAN|DKFZp762L185|NA|N...    133   1e-031
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...    131   7e-031
hg18||uc003kuv |5|X62009|NA|NA|FBN2|NA|NA|Homo sapiens mRNA for ...    131   7e-031
hg18||uc002rzh |2|NM_004105|Q12805|FBLN3_HUMAN|EFEMP1|NM_004105|...    123   1e-028
hg18||uc002rzi |2|NM_001039348|Q12805|FBLN3_HUMAN|EFEMP1|NM_0010...    123   1e-028
hg18||uc002rzj |2|NM_001039349|Q12805|FBLN3_HUMAN|EFEMP1|NM_0010...    123   1e-028
hg18||uc001oeh |11|AK124524|NA|NA|LTBP3|NM_021070|NP_066548|late...    120   1e-027
hg18||uc001oei |11|NM_021070|Q9NS15-2|Q9NS15-2|LTBP3|NM_021070|N...    120   1e-027
hg18||uc001oej |11|AK024477|Q9NS15|LTBP3_HUMAN|LTBP3|NM_021070|N...    120   1e-027
hg18||uc002mfw |19|NM_001974|Q2I7G5|Q2I7G5_HUMAN|EMR1|NM_001974|...    119   3e-027
hg18||uc002oog |19|NM_003573|NA|NA|LTBP4|NM_003573|NP_003564|lat...    116   2e-026
hg18||uc002ooh |19|NM_001042544|NA|NA|LTBP4|NM_001042544|NP_0010...    116   2e-026
hg18||uc002ooi |19|NM_001042545|NA|NA|LTBP4|NM_001042545|NP_0010...    116   2e-026
hg18||uc002ook |19|AF054502|O75441|O75441_HUMAN|LTBP4|NM_0010425...    116   2e-026
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...    115   4e-026
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...    111   4e-025
hg18||uc001rof |12|D89629|Q96JS2|Q96JS2_HUMAN|NELL2|NM_006159|NP...    107   8e-024
hg18||uc001rog |12|BC020544|Q99435|NELL2_HUMAN|NELL2|NM_006159|N...    107   8e-024
hg18||uc001roh |12|NM_006159|Q99435|NELL2_HUMAN|NELL2|NM_006159|...    107   8e-024
hg18||uc001roi |12|AK095637|Q99435|NELL2_HUMAN|NELL2|NM_006159|N...    107   8e-024
hg18||uc001xqa |14|NM_000428|Q59EE6|Q59EE6_HUMAN|LTBP2|NM_000428...    107   1e-023
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...    104   9e-023
hg18||uc001ofy |11|NM_016938|O95967|FBLN4_HUMAN|EFEMP2|NM_016938...    102   3e-022
hg18||uc001oga |11|CR605879|NA|NA|MBP1|NA|NA|Homo sapiens mRNA f...    102   3e-022
hg18||uc003bdt |22|NM_173050|Q8IWY4|SCUB1_HUMAN|SCUBE1|NM_173050...    102   3e-022
hg18||uc003okf |6|NM_152753|Q8IX30|SCUB3_HUMAN|SCUBE3|NM_152753|...    101   6e-022
hg18||uc003okg |6|BC052263|Q8IX30|SCUB3_HUMAN|SCUBE3|NM_152753|N...    101   6e-022
hg18||uc001hxo |1|NM_002508|P14543|NID1_HUMAN|NID1|NM_002508|NP_...     99   2e-021
hg18||uc003okh |6|AX747339|Q8IX30-2|Q8IX30-2|SCUBE3|NM_152753|NP...     98   4e-021
hg18||uc003dej |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|N...     97   6e-021
hg18||uc004chz |9|NM_017617|Q5SXM3|Q5SXM3_HUMAN|NOTCH1|NM_017617...     97   6e-021
hg18||uc001tjw |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|...     94   9e-020
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...     94   9e-020
hg18||uc002mjf |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP...     91   5e-019
hg18||uc002mjf |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP...     91   6e-019
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...     91   8e-019
hg18||uc002mjf |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP...     89   3e-018
hg18||uc001ioo |10|NM_001081|O60494|CUBN_HUMAN|CUBN|NM_001081|NP...     88   4e-018
hg18||uc001mqe |11|NM_006157|Q92832|NELL1_HUMAN|NELL1|NM_006157|...     88   5e-018
hg18||uc001mqf |11|BC096103|Q4VB91|Q4VB91_HUMAN|NELL1|NM_006157|...     88   5e-018
hg18||uc001ioo |10|NM_001081|O60494|CUBN_HUMAN|CUBN|NM_001081|NP...     87   7e-018
hg18||uc003kuu |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_...     86   1e-017
hg18||uc001mqe |11|NM_006157|Q92832|NELL1_HUMAN|NELL1|NM_006157|...     86   2e-017
hg18||uc001mqf |11|BC096103|Q4VB91|Q4VB91_HUMAN|NELL1|NM_006157|...     86   2e-017
hg18||uc002rzh |2|NM_004105|Q12805|FBLN3_HUMAN|EFEMP1|NM_004105|...     85   4e-017
hg18||uc002rzi |2|NM_001039348|Q12805|FBLN3_HUMAN|EFEMP1|NM_0010...     85   4e-017
hg18||uc002rzj |2|NM_001039349|Q12805|FBLN3_HUMAN|EFEMP1|NM_0010...     85   4e-017
hg18||uc003bya |3|NM_001004019|NA|NA|FBLN2|NM_001004019|NP_00100...     83   1e-016
hg18||uc001grs |1|AL833232|Q69YJ3|Q69YJ3_HUMAN|DKFZp762L185|NA|N...     83   2e-016
hg18||uc004cvi |X|NM_015507|Q8IUX8|Q8IUX8_HUMAN|EGFL6|NM_015507|...     83   2e-016
hg18||uc004cvj |X|AJ245671|Q9NY67|Q9NY67_HUMAN|EGFL6|NM_015507|N...     83   2e-016
hg18||uc001hxo |1|NM_002508|P14543|NID1_HUMAN|NID1|NM_002508|NP_...     82   2e-016
hg18||uc003dej |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|N...     80   1e-015
hg18||uc002nan |19|NM_000435|Q9UM47|NOTC3_HUMAN|NOTCH3|NM_000435...     77   7e-015
hg18||uc002nao |19|AB209447|NA|NA|NOTCH3|NM_000435|NP_000426|Not...     77   7e-015
hg18||uc001tjw |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|...     77   9e-015
hg18||uc003dej |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|N...     77   9e-015
hg18||uc001eik |1|NM_024408|Q5VTD0|Q5VTD0_HUMAN|NOTCH2|NM_024408...     76   2e-014
hg18||uc001eil |1|BC071562|Q6IQ50|Q6IQ50_HUMAN|NOTCH2|NM_024408|...     76   2e-014
hg18||uc003bdt |22|NM_173050|Q8IWY4|SCUB1_HUMAN|SCUBE1|NM_173050...     72   3e-013
hg18||uc003bdu |22|BC047916|Q86TI6|Q86TI6_HUMAN|SCUBE1|NA|NA|SCU...     72   3e-013
hg18||uc003bgg |22|NM_006487|P23142-2|P23142-2|FBLN1|NM_006487|N...     70   8e-013
hg18||uc003bgh |22|NM_001996|P23142-4|P23142-4|FBLN1|NM_001996|N...     70   8e-013
hg18||uc003bgi |22|NM_006485|P23142-2|P23142-2|FBLN1|NM_006485|N...     70   8e-013
hg18||uc003bgj |22|NM_006486|P23142|FBLN1_HUMAN|FBLN1|NM_006486|...     70   8e-013
hg18||uc003byb |3|NM_001998|NA|NA|FBLN2|NM_001998|NP_001989|fibu...     70   1e-012
hg18||uc001oeh |11|AK124524|NA|NA|LTBP3|NM_021070|NP_066548|late...     69   2e-012
hg18||uc001oei |11|NM_021070|Q9NS15-2|Q9NS15-2|LTBP3|NM_021070|N...     69   2e-012
hg18||uc001oej |11|AK024477|Q9NS15|LTBP3_HUMAN|LTBP3|NM_021070|N...     69   2e-012
hg18||uc001eik |1|NM_024408|Q5VTD0|Q5VTD0_HUMAN|NOTCH2|NM_024408...     69   2e-012
hg18||uc001eil |1|BC071562|Q6IQ50|Q6IQ50_HUMAN|NOTCH2|NM_024408|...     69   2e-012
hg18||uc001grq |1|NM_031935|Q96RW7|HMCN1_HUMAN|HMCN1|NM_031935|N...     69   2e-012
hg18||uc002myl |19|NM_078481|P48960|CD97_HUMAN|CD97|NM_078481|NP...     68   4e-012
hg18||uc002mzo |19|NM_152919|Q53GP0|Q53GP0_HUMAN|EMR2|NM_152919|...     68   5e-012
hg18||uc002mzp |19|NM_013447|Q9UHX3|EMR2_HUMAN|EMR2|NM_013447|NP...     68   5e-012
hg18||uc002mym |19|NM_001025160|P48960-3|P48960-3|CD97|NM_001025...     63   1e-010
hg18||uc003hzy |4|NM_001963|P01133|EGF_HUMAN|EGF|NM_001963|NP_00...     63   1e-010
hg18||uc002mzq |19|NM_152920|NA|NA|EMR2|NM_152920|NP_690884|egf-...     63   2e-010
hg18||uc002mzr |19|NM_152916|NA|NA|EMR2|NM_152916|NP_690880|egf-...     63   2e-010
hg18||uc001emm |1|BC090943|Q7Z3S9|Q7Z3S9_HUMAN|NOTCH2NL|NM_20345...     62   4e-010
hg18||uc001emn |1|NM_203458|Q7Z3S9|Q7Z3S9_HUMAN|NOTCH2NL|NM_2034...     62   4e-010
hg18||uc001emo |1|AK075065|Q5VTG9|Q5VTG9_HUMAN|NOTCH2NL|NM_20345...     62   4e-010
hg18||uc001rof |12|D89629|Q96JS2|Q96JS2_HUMAN|NELL2|NM_006159|NP...     61   7e-010
hg18||uc001rog |12|BC020544|Q99435|NELL2_HUMAN|NELL2|NM_006159|N...     61   7e-010
hg18||uc001roh |12|NM_006159|Q99435|NELL2_HUMAN|NELL2|NM_006159|...     61   7e-010
hg18||uc001roi |12|AK095637|Q99435|NELL2_HUMAN|NELL2|NM_006159|N...     57   7e-009
hg18||uc001mqe |11|NM_006157|Q92832|NELL1_HUMAN|NELL1|NM_006157|...     57   1e-008
hg18||uc001wzo |14|NM_007361|Q14112|NID2_HUMAN|NID2|NM_007361|NP...     57   1e-008
hg18||uc001wzp |14|BX648241|Q5CZI2|Q5CZI2_HUMAN|NID2|NM_007361|N...     57   1e-008
hg18||uc003hya |4|NM_001033047|Q6UXI9|Q6UXI9_HUMAN|NPNT|NM_00103...     55   3e-008
hg18||uc001ioo |10|NM_001081|O60494|CUBN_HUMAN|CUBN|NM_001081|NP...     54   6e-008
hg18||uc002mfw |19|NM_001974|Q2I7G5|Q2I7G5_HUMAN|EMR1|NM_001974|...     53   1e-007
hg18||uc002mzq |19|NM_152920|NA|NA|EMR2|NM_152920|NP_690884|egf-...     52   4e-007
hg18||uc002mzr |19|NM_152916|NA|NA|EMR2|NM_152916|NP_690880|egf-...     52   4e-007
hg18||uc001roj |12|AK056082|NA|NA|NELL2|NM_006159|NP_006150|nel-...     50   9e-007

>hg18||uc001zwx
        |15|NM_000138|P35555|FBN1_HUMAN|FBN1|NM_000138|NP_000129|fibrillin 1
        precursor

          Length = 2871

 Score =  148 bits (371), Expect = 5e-036
 Identities = 70/163 (42%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query:   10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANAL 69
            |.||.||  | |.|   | | || ||. | |  |.|||| .| |..||      |  .| 
Sbjct: 1320 CTDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHAD 1379

Query:   70 CTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCNAGYKGNG 129
            | |  ||    || |..|||| | |..||.       |  | | || | | |. |.  . 
Sbjct: 1380 CKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSA 1439

Query:  130 N-YLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
            .   | ||||||  | .|     .  | |||| .|| |  |.|
Sbjct: 1440 DGKACEDIDECS-LPNICV----FGTCHNLPGLFRCECEIGYE 1477

>hg18||uc002mjf
        |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP_115823|fibrillin 3
        precursor

          Length = 2809

 Score =  147 bits (369), Expect = 9e-036
 Identities = 71/164 (43%), Positives = 94/164 (57%), Gaps = 8/164 (4%)

Query:   10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANAL 69
            |||.|||  | |.|   | | |  ||.|| || |..||| || |..||      |     
Sbjct: 1278 CSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGD 1337

Query:   70 CTNREGSRLRKCKVGFSGDGFECADVNEC-NNQKICHWNATCTNNPGSYVCTCNAGYKGN 128
            | |  ||    |. ||.|||| | | .||  |  .|  |  | | || | | |  |.   
Sbjct: 1338 CLNVPGSYRCTCRQGFAGDGFFCEDRDECAENVDLCD-NGQCLNAPGGYRCECEMGFDPT 1396

Query:  129 GNY-LCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
             ..  | |.|||..   ||.    .  |.|||| .|| |. |.|
Sbjct: 1397 EDHRACQDVDECAQ-GNLCA----FGSCENLPGMFRCICNGGYE 1435

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  144 bits (362), Expect = 6e-035
 Identities = 69/164 (42%), Positives = 90/164 (54%), Gaps = 8/164 (4%)

Query:   10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANAL 69
            |.|.|||  | |.|   | | |  ||. | |  |.||.| .| |..||      |  || 
Sbjct: 1365 CTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQ 1424

Query:   70 CTNREGSRLRKCKVGFSGDGFECADVNEC-NNQKICHWNATCTNNPGSYVCTCNAGY-KG 127
            | |  ||    |  ||.|||| |.||.||  |  .|  |  | | ||.| | |  |.   
Sbjct: 1425 CVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCE-NGQCLNVPGAYRCECEMGFTPA 1483

Query:  128 NGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
            . .  | ||||||       .   .  | |||| . | |  |.|
Sbjct: 1484 SDSRSCQDIDECS-----FQNICVFGTCNNLPGMFHCICDDGYE 1522

>hg18||uc002mjf
        |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP_115823|fibrillin 3
        precursor

          Length = 2809

 Score =  136 bits (340), Expect = 2e-032
 Identities = 71/165 (43%), Positives = 91/165 (55%), Gaps = 9/165 (5%)

Query:   10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IGDGAE-CQDINECQKDNGGCHAN 67
            | |.|||    | |     | || ||. | |  || .  ||  | |..||.     | ..
Sbjct: 1236 CVDVDECDLNPHIC-LHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSH 1294

Query:   68 ALCTNREGSRLRKCKVGFSGDGFECADVNECNNQK-ICHWNATCTNNPGSYVCTCNAGYK 126
            | | |  ||   .|  |. |||||| |..|| .|.  |     | | |||| |||  |. 
Sbjct: 1295 ASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFA 1354

Query:  127 GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
            |.| . | | |||.|   || .      | | || ||| |  ||.
Sbjct: 1355 GDG-FFCEDRDECAENVDLCDNG----QCLNAPGGYRCECEMGFD 1394

>hg18||uc001grq
        |1|NM_031935|Q96RW7|HMCN1_HUMAN|HMCN1|NM_031935|NP_114141|hemicentin 1

          Length = 5635

 Score =  133 bits (333), Expect = 1e-031
 Identities = 73/171 (42%), Positives = 91/171 (53%), Gaps = 13/171 (7%)

Query:    6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCF--CLSGY--IGDGAECQDINECQKDN 61
            ||  | |||||  | |.||    |.||.||| |   | ||.    ||  |||||||| ..
Sbjct: 5141 DGRTCQDIDECALGRHTCHAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQ-ES 5199

Query:   62 GGCHANALCTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVC-- 119
              ||    | |  ||    |. |.   | .| |||||  | .|  .  | |  | | |  
Sbjct: 5200 SPCHQR--CFNAIGSFHCGCEPGYQLKGRKCMDVNEC-RQNVCRPDQHCKNTRGGYKCID 5256

Query:  120 TCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
             |  |     |  |.||||| .  . |  .   . |.|  ||||| |  |.
Sbjct: 5257 LCPNGMTKAENGTCIDIDECKDGTHQCRYN---QICENTRGSYRCVCPRGY 5304

>hg18||uc001grs |1|AL833232|Q69YJ3|Q69YJ3_HUMAN|DKFZp762L185|NA|NA|Hypothetical
        protein DKFZp762L185 (Fragment)

          Length = 1087

 Score =  133 bits (333), Expect = 1e-031
 Identities = 73/171 (42%), Positives = 91/171 (53%), Gaps = 13/171 (7%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCF--CLSGY--IGDGAECQDINECQKDN 61
           ||  | |||||  | |.||    |.||.||| |   | ||.    ||  |||||||| ..
Sbjct: 710 DGRTCQDIDECALGRHTCHAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQ-ES 768

Query:  62 GGCHANALCTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVC-- 119
             ||    | |  ||    |. |.   | .| |||||  | .|  .  | |  | | |  
Sbjct: 769 SPCHQR--CFNAIGSFHCGCEPGYQLKGRKCMDVNEC-RQNVCRPDQHCKNTRGGYKCID 825

Query: 120 TCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |  |     |  |.||||| .  . |  .   . |.|  ||||| |  |.
Sbjct: 826 LCPNGMTKAENGTCIDIDECKDGTHQCRYN---QICENTRGSYRCVCPRGY 873

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  131 bits (327), Expect = 7e-031
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 9/164 (5%)

Query:   10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IGDGAE-CQDINECQKDNGGCHAN 67
            | |..||    . |     | || ||. | |  || .  |   | |..||.     |  .
Sbjct: 1323 CIDVNECDLNSNIC-MFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMH 1381

Query:   68 ALCTNREGSRLRKCKVGFSGDGFECADVNECNN-QKICHWNATCTNNPGSYVCTCNAGYK 126
            | | |  ||    |. |. |.| .| |..||.|    |  || | | |||| | |. |. 
Sbjct: 1382 ASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFT 1441

Query:  127 GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |.| . | |.|||.|   || .      | |.||.||| |  ||
Sbjct: 1442 GDG-FTCSDVDECAENINLCENG----QCLNVPGAYRCECEMGF 1480

>hg18||uc003kuv |5|X62009|NA|NA|FBN2|NA|NA|Homo sapiens mRNA for fibrillin 2
        (congenital contractural arachnodactyly) variant protein

          Length = 507

 Score =  131 bits (327), Expect = 7e-031
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 9/164 (5%)

Query:  10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IGDGAE-CQDINECQKDNGGCHAN 67
           | |..||    . |     | || ||. | |  || .  |   | |..||.     |  .
Sbjct: 324 CIDVNECDLNSNIC-MFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMH 382

Query:  68 ALCTNREGSRLRKCKVGFSGDGFECADVNECNN-QKICHWNATCTNNPGSYVCTCNAGYK 126
           | | |  ||    |. |. |.| .| |..||.|    |  || | | |||| | |. |. 
Sbjct: 383 ASCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFT 442

Query: 127 GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           |.| . | |.|||.|   || .      | |.||.||| |  ||
Sbjct: 443 GDG-FTCSDVDECAENINLCENG----QCLNVPGAYRCECEMGF 481

>hg18||uc002rzh
        |2|NM_004105|Q12805|FBLN3_HUMAN|EFEMP1|NM_004105|NP_004096|EGF-containi
        ng fibulin-like extracellular matrix

          Length = 493

 Score =  123 bits (307), Expect = 1e-028
 Identities = 67/174 (38%), Positives = 90/174 (51%), Gaps = 14/174 (8%)

Query:   2 GY-QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKD 60
           || | .  .| ||||| .| |.|     | |  ||..| |  ||   | .| ||.||   
Sbjct: 162 GYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIP 221

Query:  61 NGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGSYV 118
              ||    | |  ||   .|  ||  . . . | |.|||.    |     | |  ||..
Sbjct: 222 -PYCHQR--CVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQC--AQQCYNILGSFI 276

Query: 119 CTCNAGYKGNGNYL-CLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
           | || ||. . . | | |||||  . |||        | | || . | |  |..
Sbjct: 277 CQCNQGYELSSDRLNCEDIDECRTSSYLCQYQ-----CVNEPGKFSCMCPQGYQ 325

>hg18||uc002rzi
        |2|NM_001039348|Q12805|FBLN3_HUMAN|EFEMP1|NM_001039348|NP_001034437|EGF
        -containing fibulin-like extracellular matrix

          Length = 493

 Score =  123 bits (307), Expect = 1e-028
 Identities = 67/174 (38%), Positives = 90/174 (51%), Gaps = 14/174 (8%)

Query:   2 GY-QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKD 60
           || | .  .| ||||| .| |.|     | |  ||..| |  ||   | .| ||.||   
Sbjct: 162 GYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIP 221

Query:  61 NGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGSYV 118
              ||    | |  ||   .|  ||  . . . | |.|||.    |     | |  ||..
Sbjct: 222 -PYCHQR--CVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQC--AQQCYNILGSFI 276

Query: 119 CTCNAGYKGNGNYL-CLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
           | || ||. . . | | |||||  . |||        | | || . | |  |..
Sbjct: 277 CQCNQGYELSSDRLNCEDIDECRTSSYLCQYQ-----CVNEPGKFSCMCPQGYQ 325

>hg18||uc002rzj
        |2|NM_001039349|Q12805|FBLN3_HUMAN|EFEMP1|NM_001039349|NP_001034438|EGF
        -containing fibulin-like extracellular matrix

          Length = 493

 Score =  123 bits (307), Expect = 1e-028
 Identities = 67/174 (38%), Positives = 90/174 (51%), Gaps = 14/174 (8%)

Query:   2 GY-QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKD 60
           || | .  .| ||||| .| |.|     | |  ||..| |  ||   | .| ||.||   
Sbjct: 162 GYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIP 221

Query:  61 NGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGSYV 118
              ||    | |  ||   .|  ||  . . . | |.|||.    |     | |  ||..
Sbjct: 222 -PYCHQR--CVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQC--AQQCYNILGSFI 276

Query: 119 CTCNAGYKGNGNYL-CLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
           | || ||. . . | | |||||  . |||        | | || . | |  |..
Sbjct: 277 CQCNQGYELSSDRLNCEDIDECRTSSYLCQYQ-----CVNEPGKFSCMCPQGYQ 325

>hg18||uc001oeh |11|AK124524|NA|NA|LTBP3|NM_021070|NP_066548|latent transforming
        growth factor beta binding

          Length = 733

 Score =  120 bits (299), Expect = 1e-027
 Identities = 70/174 (40%), Positives = 88/174 (50%), Gaps = 13/174 (7%)

Query:   2 GYQGD-GLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY--IGDGAECQDINECQ 58
           ||.   |  | |..||  |   | |   | |  ||. | |  ||    ||  | |..||.
Sbjct: 163 GYRSQGGGACRDVNECAEG-SPCSP-GWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECE 220

Query:  59 KDNGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGS 116
              |    | .|.|  ||   .|  |.  | |   | |..||.    |     | |  ||
Sbjct: 221 A--GDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAAC-IGGDCINTNGS 277

Query: 117 YVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           | | |  |..  |   | ||||||. | ||   | .  |||| ||| | |  ||
Sbjct: 278 YRCLCPQGHRLVGGRKCQDIDECSQDPSLC---LPHGACKNLQGSYVCVCDEGF 328

>hg18||uc001oei |11|NM_021070|Q9NS15-2|Q9NS15-2|LTBP3|NM_021070|NP_066548|latent
        transforming growth factor beta binding

          Length = 1256

 Score =  120 bits (299), Expect = 1e-027
 Identities = 70/174 (40%), Positives = 88/174 (50%), Gaps = 13/174 (7%)

Query:   2 GYQGD-GLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY--IGDGAECQDINECQ 58
           ||.   |  | |..||  |   | |   | |  ||. | |  ||    ||  | |..||.
Sbjct: 733 GYRSQGGGACRDVNECAEG-SPCSP-GWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECE 790

Query:  59 KDNGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGS 116
              |    | .|.|  ||   .|  |.  | |   | |..||.    |     | |  ||
Sbjct: 791 A--GDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAAC-IGGDCINTNGS 847

Query: 117 YVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           | | |  |..  |   | ||||||. | ||   | .  |||| ||| | |  ||
Sbjct: 848 YRCLCPQGHRLVGGRKCQDIDECSQDPSLC---LPHGACKNLQGSYVCVCDEGF 898

>hg18||uc001oej |11|AK024477|Q9NS15|LTBP3_HUMAN|LTBP3|NM_021070|NP_066548|latent
        transforming growth factor beta binding

          Length = 1289

 Score =  120 bits (299), Expect = 1e-027
 Identities = 70/174 (40%), Positives = 88/174 (50%), Gaps = 13/174 (7%)

Query:   2 GYQGD-GLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY--IGDGAECQDINECQ 58
           ||.   |  | |..||  |   | |   | |  ||. | |  ||    ||  | |..||.
Sbjct: 719 GYRSQGGGACRDVNECAEG-SPCSP-GWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECE 776

Query:  59 KDNGGCHANALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGS 116
              |    | .|.|  ||   .|  |.  | |   | |..||.    |     | |  ||
Sbjct: 777 A--GDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAAC-IGGDCINTNGS 833

Query: 117 YVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           | | |  |..  |   | ||||||. | ||   | .  |||| ||| | |  ||
Sbjct: 834 YRCLCPQGHRLVGGRKCQDIDECSQDPSLC---LPHGACKNLQGSYVCVCDEGF 884

>hg18||uc002mfw
        |19|NM_001974|Q2I7G5|Q2I7G5_HUMAN|EMR1|NM_001974|NP_001965|egf-like
        module containing, mucin-like, hormone

          Length = 886

 Score =  119 bits (296), Expect = 3e-027
 Identities = 65/174 (37%), Positives = 88/174 (50%), Gaps = 24/174 (13%)

Query:  10 CSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANAL 69
           |.||.|||.    |   . | |..||||| |  |.|   . |.|..||  |   |  .| 
Sbjct: 130 CTDINECLTS-SVCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDEC-ADPRACPEHAT 187

Query:  70 CTNREGSRLRKCKVG---------FSGDGFECADVNECNNQKICHWNATCTNNPGSYVCT 120
           | |  |.    |  |         | |    | |..||   ..|  |.|||| |||| ||
Sbjct: 188 CNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECT--EMCPINSTCTNTPGSYFCT 245

Query: 121 CNAGYKGNGNYL--------CLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTC 166
           |. |.  .   |        | ||||| . |  |  .     | |  ||| | |
Sbjct: 246 CHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPN---SICTNALGSYSCGC 296

>hg18||uc002oog |19|NM_003573|NA|NA|LTBP4|NM_003573|NP_003564|latent
        transforming growth factor beta binding

          Length = 1587

 Score =  116 bits (289), Expect = 2e-026
 Identities = 67/168 (39%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query:   7 GLLCSDIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKDNGGCH 65
           |  | |.||| .  |   |   | |. ||. |  | ||.      | |..||      | 
Sbjct: 752 GSECEDVDECEN--HLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCG 809

Query:  66 ANALCTNREGSRLRKCKVGF---SGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            .  ||| |||    |  |.   ||    |||||||     |  .  | |  ||. ||| 
Sbjct: 810 PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCA 869

Query: 123 AGYK-GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            ||. |     |||.|||||   || | .    | |  ||. | |  |
Sbjct: 870 PGYRPGPRGASCLDVDECSEED-LCQSGI----CTNTDGSFECICPPG 912

>hg18||uc002ooh |19|NM_001042544|NA|NA|LTBP4|NM_001042544|NP_001036009|latent
        transforming growth factor beta binding

          Length = 1624

 Score =  116 bits (289), Expect = 2e-026
 Identities = 67/168 (39%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query:   7 GLLCSDIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKDNGGCH 65
           |  | |.||| .  |   |   | |. ||. |  | ||.      | |..||      | 
Sbjct: 789 GSECEDVDECEN--HLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCG 846

Query:  66 ANALCTNREGSRLRKCKVGF---SGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            .  ||| |||    |  |.   ||    |||||||     |  .  | |  ||. ||| 
Sbjct: 847 PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCA 906

Query: 123 AGYK-GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            ||. |     |||.|||||   || | .    | |  ||. | |  |
Sbjct: 907 PGYRPGPRGASCLDVDECSEED-LCQSGI----CTNTDGSFECICPPG 949

>hg18||uc002ooi |19|NM_001042545|NA|NA|LTBP4|NM_001042545|NP_001036010|latent
        transforming growth factor beta binding

          Length = 1557

 Score =  116 bits (289), Expect = 2e-026
 Identities = 67/168 (39%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query:   7 GLLCSDIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKDNGGCH 65
           |  | |.||| .  |   |   | |. ||. |  | ||.      | |..||      | 
Sbjct: 722 GSECEDVDECEN--HLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCG 779

Query:  66 ANALCTNREGSRLRKCKVGF---SGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            .  ||| |||    |  |.   ||    |||||||     |  .  | |  ||. ||| 
Sbjct: 780 PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCA 839

Query: 123 AGYK-GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            ||. |     |||.|||||   || | .    | |  ||. | |  |
Sbjct: 840 PGYRPGPRGASCLDVDECSEED-LCQSGI----CTNTDGSFECICPPG 882

>hg18||uc002ook
        |19|AF054502|O75441|O75441_HUMAN|LTBP4|NM_001042545|NP_001036010|latent
        transforming growth factor beta binding

          Length = 707

 Score =  116 bits (289), Expect = 2e-026
 Identities = 67/168 (39%), Positives = 82/168 (48%), Gaps = 12/168 (7%)

Query:   7 GLLCSDIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKDNGGCH 65
           |  | |.||| .  |   |   | |. ||. |  | ||.      | |..||      | 
Sbjct:   9 GSECEDVDECEN--HLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSSGAPPCG 66

Query:  66 ANALCTNREGSRLRKCKVGF---SGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            .  ||| |||    |  |.   ||    |||||||     |  .  | |  ||. ||| 
Sbjct:  67 PHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCA 126

Query: 123 AGYK-GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            ||. |     |||.|||||   || | .    | |  ||. | |  |
Sbjct: 127 PGYRPGPRGASCLDVDECSEED-LCQSGI----CTNTDGSFECICPPG 169

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  115 bits (286), Expect = 4e-026
 Identities = 66/170 (38%), Positives = 84/170 (49%), Gaps = 12/170 (7%)

Query:    4 QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGG 63
            | ||  | |.||| .  |.|  .  | |||| ..| |  |.      | | |||      
Sbjct: 2524 QEDGKTCKDLDECQTKQHNC--QFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSL 2581

Query:   64 CHANALCTNREGSRLRKCKVGFSGD--GFECADVNECNNQKICHWNATCTNNPGSYVCTC 121
            | |  .| |  ||   .|. ||| |  |  | ||.||.    |     | |  | | | |
Sbjct: 2582 CGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHG--CQNILGGYRCGC 2639

Query:  122 NAGYKGNGNY-LCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
              ||  .  .  |.| .|||  |  | |.     | |  |||.| |  ||
Sbjct: 2640 PQGYIQHYQWNQCVDENECS-NPNACGSA----SCYNTLGSYKCACPSGF 2684

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  111 bits (277), Expect = 4e-025
 Identities = 66/168 (39%), Positives = 87/168 (51%), Gaps = 11/168 (6%)

Query:    8 LLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IGDGAECQDINECQKDNGGCHA 66
            |.| ||||| .| . |   | | |. ||| | | .|. .     | | ||| .    | .
Sbjct: 1846 LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVC-S 1904

Query:   67 NALCTNREGSRLRKCKVGF--SGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCNAG 124
            . || . .||    |  ||  | |   | ||.||        | || |  ||| | |  |
Sbjct: 1905 HGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPC--GNGTCKNTVGSYNCLCYPG 1962

Query:  125 YKGNGNYLCLDIDECSE-TPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
            ..   |  ||||||||     .| .      | |  ||..| |. |.|
Sbjct: 1963 FELTHNNDCLDIDECSSFFGQVCRNG----RCFNEIGSFKCLCNEGYE 2006

>hg18||uc001rof
        |12|D89629|Q96JS2|Q96JS2_HUMAN|NELL2|NM_006159|NP_006150|nel-like 2

          Length = 815

 Score =  107 bits (266), Expect = 8e-024
 Identities = 63/169 (37%), Positives = 76/169 (44%), Gaps = 19/169 (11%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNGGC 64
           |   | |||||  | | |     | || ||. | | .|||  |   | . .||  .   |
Sbjct: 433 DNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQHNC 492

Query:  65 HANALCTNREGSRLRKCKVGFSGDGFECADV--NECNNQKICHWNATCTNNPGSYVCTCN 122
             |||| |  |     || |..|.|  |     . | |   |           . || | 
Sbjct: 493 DENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGAC---------IAANVCACP 543

Query: 123 AGYKGNGNYLC-LDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |. |     |  ||||||.    | |      | |||| | | |  |.
Sbjct: 544 QGFTGPS---CETDIDECSDGFVQCDSR---ANCINLPGWYHCECRDGY 586

>hg18||uc001rog
        |12|BC020544|Q99435|NELL2_HUMAN|NELL2|NM_006159|NP_006150|nel-like 2

          Length = 816

 Score =  107 bits (266), Expect = 8e-024
 Identities = 63/169 (37%), Positives = 76/169 (44%), Gaps = 19/169 (11%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNGGC 64
           |   | |||||  | | |     | || ||. | | .|||  |   | . .||  .   |
Sbjct: 434 DNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQHNC 493

Query:  65 HANALCTNREGSRLRKCKVGFSGDGFECADV--NECNNQKICHWNATCTNNPGSYVCTCN 122
             |||| |  |     || |..|.|  |     . | |   |           . || | 
Sbjct: 494 DENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGAC---------IAANVCACP 544

Query: 123 AGYKGNGNYLC-LDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |. |     |  ||||||.    | |      | |||| | | |  |.
Sbjct: 545 QGFTGPS---CETDIDECSDGFVQCDSR---ANCINLPGWYHCECRDGY 587

>hg18||uc001roh
        |12|NM_006159|Q99435|NELL2_HUMAN|NELL2|NM_006159|NP_006150|nel-like 2

          Length = 816

 Score =  107 bits (266), Expect = 8e-024
 Identities = 63/169 (37%), Positives = 76/169 (44%), Gaps = 19/169 (11%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNGGC 64
           |   | |||||  | | |     | || ||. | | .|||  |   | . .||  .   |
Sbjct: 434 DNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQHNC 493

Query:  65 HANALCTNREGSRLRKCKVGFSGDGFECADV--NECNNQKICHWNATCTNNPGSYVCTCN 122
             |||| |  |     || |..|.|  |     . | |   |           . || | 
Sbjct: 494 DENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGAC---------IAANVCACP 544

Query: 123 AGYKGNGNYLC-LDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |. |     |  ||||||.    | |      | |||| | | |  |.
Sbjct: 545 QGFTGPS---CETDIDECSDGFVQCDSR---ANCINLPGWYHCECRDGY 587

>hg18||uc001roi
        |12|AK095637|Q99435|NELL2_HUMAN|NELL2|NM_006159|NP_006150|nel-like 2

          Length = 666

 Score =  107 bits (266), Expect = 8e-024
 Identities = 63/169 (37%), Positives = 76/169 (44%), Gaps = 19/169 (11%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNGGC 64
           |   | |||||  | | |     | || ||. | | .|||  |   | . .||  .   |
Sbjct: 434 DNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQHNC 493

Query:  65 HANALCTNREGSRLRKCKVGFSGDGFECADV--NECNNQKICHWNATCTNNPGSYVCTCN 122
             |||| |  |     || |..|.|  |     . | |   |           . || | 
Sbjct: 494 DENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGAC---------IAANVCACP 544

Query: 123 AGYKGNGNYLC-LDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
            |. |     |  ||||||.    | |      | |||| | | |  |.
Sbjct: 545 QGFTGPS---CETDIDECSDGFVQCDSR---ANCINLPGWYHCECRDGY 587

>hg18||uc001xqa
        |14|NM_000428|Q59EE6|Q59EE6_HUMAN|LTBP2|NM_000428|NP_000419|latent
        transforming growth factor beta binding

          Length = 1821

 Score =  107 bits (265), Expect = 1e-023
 Identities = 61/171 (35%), Positives = 78/171 (45%), Gaps = 13/171 (7%)

Query:    6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGD--GAECQDINECQKDNG 62
            ||  | |.|||        |   | || ||.||  |  ||     |  |.|..||.    
Sbjct: 1087 DGTACEDLDEC--AFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECEDPQS 1144

Query:   63 GCHANALCTNREGSRLRKCKVGFS-GDGFECADVNECNNQKICHWNATCTNNPGSYVCTC 121
             |     | |  ||    |  ||   .|  | |||||  .. |  .  | |. ||. | |
Sbjct: 1145 SC-LGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLC 1203

Query:  122 NAGY-KGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGFE 171
              |.    |   | |.|||. |            | |  ||. | |  ||.
Sbjct: 1204 APGFVSAEGGTSCQDVDECATTDPCVGGH-----CVNTEGSFNCLCETGFQ 1249

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  104 bits (257), Expect = 9e-023
 Identities = 54/122 (44%), Positives = 74/122 (60%), Gaps = 8/122 (6%)

Query:   53 DINECQKDNGGCHANALCTNREGSRLRKCKVGFSGDG--FECADVNECNN-QKICHWNAT 109
            ||.||..  | | || .| |. ||   .|  ||| .     | |..||.|   .|  || 
Sbjct: 1808 DIDECKEIPGIC-ANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNAD 1866

Query:  110 CTNNPGSYVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            | |.|||| | | ||.| . |  |.| .|| | | .||  |    | .| |||.| |  |
Sbjct: 1867 CINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGL----CVDLQGSYQCICHNG 1922

Query:  170 FE 171
            |.
Sbjct: 1923 FK 1924

>hg18||uc001ofy
        |11|NM_016938|O95967|FBLN4_HUMAN|EFEMP2|NM_016938|NP_058634|EGF-contain
        ing fibulin-like extracellular matrix

          Length = 443

 Score =  102 bits (252), Expect = 3e-022
 Identities = 61/168 (36%), Positives = 84/168 (50%), Gaps = 17/168 (10%)

Query:   2 GYQGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IG-DGAECQDINECQK 59
           ||.  |  | |||||       . . || |  ||. | |  |. .| .   | |.|||  
Sbjct: 154 GYRKIGPECVDIDEC----RYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDM 209

Query:  60 DNGGCHANALCTNREGSRLRKCKVGFS--GDGFECADVNECN-NQKICHWNATCTNNPGS 116
              |      | |  |. | .|  |.    ||| |.|..||. .  .| .   | | || 
Sbjct: 210 ---GAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYR--CINEPGR 264

Query: 117 YVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRC 164
           . | |  ||.     || |||||    . || .   . | |  | |||
Sbjct: 265 FSCHCPQGYQLLATRLCQDIDECESGAHQCSEA---QTCVNFHGGYRC 309

>hg18||uc001oga |11|CR605879|NA|NA|MBP1|NA|NA|Homo sapiens mRNA for mutant p53
        binding protein 1 (MBP1), complete cds

          Length = 436

 Score =  102 bits (252), Expect = 3e-022
 Identities = 61/168 (36%), Positives = 84/168 (50%), Gaps = 17/168 (10%)

Query:   2 GYQGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IG-DGAECQDINECQK 59
           ||.  |  | |||||       . . || |  ||. | |  |. .| .   | |.|||  
Sbjct: 154 GYRKIGPECVDIDEC----RYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDM 209

Query:  60 DNGGCHANALCTNREGSRLRKCKVGFS--GDGFECADVNECN-NQKICHWNATCTNNPGS 116
              |      | |  |. | .|  |.    ||| |.|..||. .  .| .   | | || 
Sbjct: 210 ---GAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQYR--CINEPGR 264

Query: 117 YVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRC 164
           . | |  ||.     || |||||    . || .   . | |  | |||
Sbjct: 265 FSCHCPQGYQLLATRLCQDIDECESGAHQCSEA---QTCVNFHGGYRC 309

>hg18||uc003bdt
        |22|NM_173050|Q8IWY4|SCUB1_HUMAN|SCUBE1|NM_173050|NP_766638|signal
        peptide, CUB domain, EGF-like 1

          Length = 988

 Score =  102 bits (252), Expect = 3e-022
 Identities = 61/168 (36%), Positives = 81/168 (48%), Gaps = 17/168 (10%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYI--GDGAECQDINECQKDNGG 63
           ||  |  |. |      |     | .|     | |  |.    ||  |.|||||  .|||
Sbjct: 237 DGRTC--IETCAVNNGGC--DRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGG 292

Query:  64 CHANALCTNREGSRLRKCKVGFS--GDGFECADVNECNNQKICHWNATCTNNPGSYVCTC 121
           |  .  | |  ||    |. |.    |   | |..||. .. |  .  | |.|||. | |
Sbjct: 293 C--DHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTC--DHICINSPGSFQCLC 348

Query: 122 NAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
           . ||   |   | |.|||| .   |      .|| |  ||| | |  |
Sbjct: 349 HRGYILYGTTHCGDVDECSMSNGSCD-----QGCVNTKGSYECVCPPG 391

>hg18||uc003okf
        |6|NM_152753|Q8IX30|SCUB3_HUMAN|SCUBE3|NM_152753|NP_689966|signal
        peptide, CUB domain, EGF-like 3

          Length = 993

 Score =  101 bits (250), Expect = 6e-022
 Identities = 61/168 (36%), Positives = 83/168 (49%), Gaps = 17/168 (10%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYI--GDGAECQDINECQKDNGG 63
           ||  |  |. |      |  |  |..      | |  |..   |   |.||.||. .|||
Sbjct: 232 DGKTC--IETCAVNNGGCDSK--CHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGG 287

Query:  64 CHANALCTNREGSRLRKCKVGFS--GDGFECADVNECNNQKICHWNATCTNNPGSYVCTC 121
           |  . .| |  ||    || |.    .   | |..||.  . |  .  | | |||. | |
Sbjct: 288 C--DHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTC--DHICVNTPGSFQCLC 343

Query: 122 NAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
           . ||   |   | |.||||     |       || | ||||.|||  |
Sbjct: 344 HRGYLLYGITHCGDVDECSINRGGCRF-----GCINTPGSYQCTCPAG 386

>hg18||uc003okg |6|BC052263|Q8IX30|SCUB3_HUMAN|SCUBE3|NM_152753|NP_689966|signal
        peptide, CUB domain, EGF-like 3

          Length = 992

 Score =  101 bits (250), Expect = 6e-022
 Identities = 61/168 (36%), Positives = 83/168 (49%), Gaps = 17/168 (10%)

Query:   6 DGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYI--GDGAECQDINECQKDNGG 63
           ||  |  |. |      |  |  |..      | |  |..   |   |.||.||. .|||
Sbjct: 231 DGKTC--IETCAVNNGGCDSK--CHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGG 286

Query:  64 CHANALCTNREGSRLRKCKVGFS--GDGFECADVNECNNQKICHWNATCTNNPGSYVCTC 121
           |  . .| |  ||    || |.    .   | |..||.  . |  .  | | |||. | |
Sbjct: 287 C--DHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTC--DHICVNTPGSFQCLC 342

Query: 122 NAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
           . ||   |   | |.||||     |       || | ||||.|||  |
Sbjct: 343 HRGYLLYGITHCGDVDECSINRGGCRF-----GCINTPGSYQCTCPAG 385

>hg18||uc001hxo |1|NM_002508|P14543|NID1_HUMAN|NID1|NM_002508|NP_002499|nidogen
        1 precursor

          Length = 1247

 Score =  99 bits (246), Expect = 2e-021
 Identities = 55/139 (39%), Positives = 69/139 (49%), Gaps = 11/139 (7%)

Query:   1 MGYQGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGY-IGDGAEC------QD 53
           .|..|||  | |||||      |     |||  |.. | |. ||   |   |      . 
Sbjct: 699 IGFRGDGRTCYDIDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRP 758

Query:  54 INECQKDNGGCH--ANALCTNREGSRLR-KCKVGFSGDGFECADVNECNNQKICHWNATC 110
           || |.     |     | |    ||     |  ||||||  | ||.||   . || .| |
Sbjct: 759 INYCETGLHNCDIPQRAQCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPSR-CHPDAFC 817

Query: 111 TNNPGSYVCTCNAGYKGNG 129
            | |||. | |  ||.|.|
Sbjct: 818 YNTPGSFTCQCKPGYQGDG 836

>hg18||uc003okh |6|AX747339|Q8IX30-2|Q8IX30-2|SCUBE3|NM_152753|NP_689966|signal
        peptide, CUB domain, EGF-like 3

          Length = 880

 Score =  98 bits (243), Expect = 4e-021
 Identities = 54/147 (36%), Positives = 77/147 (52%), Gaps = 13/147 (8%)

Query:  27 ARCNNTLGSYSCFCLSGYI--GDGAECQDINECQKDNGGCHANALCTNREGSRLRKCKVG 84
           ..|..      | |  |..   |   |.||.||. .||||  . .| |  ||    || |
Sbjct: 136 SKCHDAATGVHCTCPVGFMLQPDRKTCKDIDECRLNNGGC--DHICRNTVGSFECSCKKG 193

Query:  85 FS--GDGFECADVNECNNQKICHWNATCTNNPGSYVCTCNAGYKGNGNYLCLDIDECSET 142
           .    .   | |..||.  . |  .  | | |||. | |. ||   |   | |.||||  
Sbjct: 194 YKLLINERNCQDIDECSFDRTC--DHICVNTPGSFQCLCHRGYLLYGITHCGDVDECSIN 251

Query: 143 PYLCSSSLGYKGCKNLPGSYRCTCSXG 169
              |       || | ||||.|||  |
Sbjct: 252 RGGCRF-----GCINTPGSYQCTCPAG 273

>hg18||uc003dej
        |3|NM_015136|Q9NY15|STAB1_HUMAN|STAB1|NM_015136|NP_055951|stabilin 1
        precursor

          Length = 2570

 Score =  97 bits (241), Expect = 6e-021
 Identities = 50/137 (36%), Positives = 69/137 (50%), Gaps = 5/137 (3%)

Query:    2 GYQGDGLLCSDIDECLSGLHSCHPKARCNNTL-GSYSCFCLSGYIGDGAECQDINECQKD 60
            || |.|. ||..| |  |   | | | |     |  .| |  ||.|||  ||.|| |   
Sbjct: 1445 GYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIH 1504

Query:   61 NGGCHANALCTNREGSRLR-KCKVGFSGDGFE-CADVNECN-NQKICHWNATC-TNNPGS 116
            .|||| .| |      ..   |. |.||||   |  .. |. |   |   ||| .   | 
Sbjct: 1505 HGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKSTGDGQ 1564

Query:  117 YVCTCNAGYKGNGNYLC 133
              |||.  .       |
Sbjct: 1565 RTCTCDTAHTVGDGLTC 1581

>hg18||uc004chz
        |9|NM_017617|Q5SXM3|Q5SXM3_HUMAN|NOTCH1|NM_017617|NP_060087|notch1
        preproprotein

          Length = 2556

 Score =  97 bits (241), Expect = 6e-021
 Identities = 62/171 (36%), Positives = 86/171 (50%), Gaps = 17/171 (9%)

Query:   2 GYQGDGLLCS-DIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKD 60
           || |    || |.|||  | . |    .| |||||. | || || |   |  |.|||   
Sbjct: 403 GYTGPA--CSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEI-DVNECV-- 457

Query:  61 NGGCHANALCTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVCT 120
           .  |  .| | .. |     |  |. |   |  . .|| .    | |  | .    . | 
Sbjct: 458 SNPCQNDATCLDQIGEFQCICMPGYEGVHCE-VNTDECASSPCLH-NGRCLDKINEFQCE 515

Query: 121 CNAGYKGNGNYLC-LDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           |  |. |   .||  |.|||. ||  | .  | | | . | .| | |. |.
Sbjct: 516 CPTGFTG---HLCQYDVDECASTP--CKN--GAK-CLDGPNTYTCVCTEGY 558

>hg18||uc001tjw
        |12|NM_017564|Q8WWQ8|STAB2_HUMAN|STAB2|NM_017564|NP_060034|stabilin 2
        precursor

          Length = 2551

 Score =  94 bits (231), Expect = 9e-020
 Identities = 56/154 (36%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query:   22 SCHPKARC-NNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANALC-TNREGSRLR 79
            .||  | |  |. |. || | .|. |.|  |  || |.  |||| | | |     | |. 
Sbjct: 1439 TCHTSANCLTNSDGTASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGRRVC 1498

Query:   80 KCKVGFSGDGFECADVNEC-NNQKICHWNATCT-NNPGSYVCTCNAGYKGNGNYLCLDID 137
             || |..|||  | ..| |  |   |  || ||   |    | |   | |.|  .|  |.
Sbjct: 1499 TCKAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGK-VCTLIN 1557

Query:  138 ECSETPYLCSSSLGYKGCKNLPGSYR-CTCSXGF 170
             |      ||    .  | .     | |||   .
Sbjct: 1558 VCLTKNGGCSE---FAICNHTGQVERTCTCKPNY 1588

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  94 bits (231), Expect = 9e-020
 Identities = 48/121 (39%), Positives = 67/121 (55%), Gaps = 9/121 (7%)

Query:   52 QDINECQKDNGGCHANALCTNREGSRLRKCKVGFSGD--GFECADVNECNNQKICHWNAT 109
            .|.||| .  | | .|  | | .||   .| .|.. |  |  | | .||.    |  | |
Sbjct: 2170 EDVNECLESPGIC-SNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPC-GNGT 2227

Query:  110 CTNNPGSYVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            |||  ||. | || |..      | ||.||.. | ||.       | |  ||| |||  |
Sbjct: 2228 CTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFR-----CMNTFGSYECTCPIG 2282

Query:  170 F 170
            .
Sbjct: 2283 Y 2283

>hg18||uc002mjf
        |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP_115823|fibrillin 3
        precursor

          Length = 2809

 Score =  91 bits (225), Expect = 5e-019
 Identities = 52/137 (37%), Positives = 70/137 (51%), Gaps = 11/137 (8%)

Query:  36 YSCFCLSGYIGDGAECQDINECQKDNGGCHANALCTNREGSRLRKCKVGF--SGDGFECA 93
           .   | || .|   . .|||||  |   | || .| |  ||    | .|.     | .| 
Sbjct: 666 FQALCSSG-LGITTDGRDINECALDPEVC-ANGVCENLRGSYRCVCNLGYEAGASGKDCT 723

Query:  94 DVNECNNQKICHWNATCTNNPGSYVCTCNAGYK-GNGNYLCLDIDECSETPYLCSSSLGY 152
           ||.||    .   |  | |.|||| |.|  |.       .| |.|||  .|  | | .  
Sbjct: 724 DVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSP--CVSGV-- 779

Query: 153 KGCKNLPGSYRCTCSXG 169
             |.|| ||| | |  |
Sbjct: 780 --CRNLAGSYTCKCGPG 794

>hg18||uc002mjf
        |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP_115823|fibrillin 3
        precursor

          Length = 2809

 Score =  91 bits (224), Expect = 6e-019
 Identities = 48/121 (39%), Positives = 63/121 (52%), Gaps = 9/121 (7%)

Query:   52 QDINECQKDNGGCHANALCTNREGSRLRKCKVGFSGD--GFECADVNECNNQKICHWNAT 109
            .|.||| .. | |  | .| | .||   .|  |.| |  |  | | .||.    |    |
Sbjct: 2083 EDVNECAENPGVC-TNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPC-GQGT 2140

Query:  110 CTNNPGSYVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            |||  | . | |  |..      | ||||||  | ||.       | |  ||| |||  |
Sbjct: 2141 CTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLCAFR-----CHNTEGSYLCTCPAG 2195

Query:  170 F 170
            .
Sbjct: 2196 Y 2196

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  91 bits (223), Expect = 8e-019
 Identities = 58/167 (34%), Positives = 79/167 (47%), Gaps = 13/167 (7%)

Query:   8 LLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIGD-GAECQDINECQKDNGGCHA 66
           .|   || |    . |    ||  |. || | |  ||  |   .| |..||   .  |  
Sbjct: 490 ILNQTIDICKHHANLC-LNGRCIPTVSSYRCECNMGYKQDANGDCIDVDEC--TSNPC-T 545

Query:  67 NALCTNREGSRLRKCKVGFSGDGFE--CADVNECNNQKICHWNATCTNNPGSYVCTCNAG 124
           |  | |  ||   ||  ||     .  | |..||    .   |  | |  ||. | ||||
Sbjct: 546 NGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAG 605

Query: 125 YK-GNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXGF 170
           ..       |.| |||. |  .| . .    | |  ||..| |  ||
Sbjct: 606 FELTTDGKNCVDHDECT-TTNMCLNGM----CINEDGSFKCICKPGF 647

>hg18||uc002mjf
        |19|NM_032447|Q75N90|FBN3_HUMAN|FBN3|NM_032447|NP_115823|fibrillin 3
        precursor

          Length = 2809

 Score =  89 bits (218), Expect = 3e-018
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 8/122 (6%)

Query:   53 DINECQKDNGGCHANALCTNREGSRLRKCKVGFSGDG--FECADVNECNNQKI-CHWNAT 109
            ||.|| .    | || .| |. ||   .|  ||. .     | ||.|| ...  |  || 
Sbjct: 1721 DIDECGEIPAIC-ANGICINQIGSFRCECPAGFNYNSILLACEDVDECGSRESPCQQNAD 1779

Query:  110 CTNNPGSYVCTCNAGYKGNGNYLCLDIDECSETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
            | | |||| | |  ||| .    |.  .|| | | .||    .  | .  ||| | |  |
Sbjct: 1780 CINIPGSYRCKCTRGYKLSPGGACVGRNECREIPNVCS----HGDCMDTEGSYMCLCHRG 1835

Query:  170 FE 171
            |.
Sbjct: 1836 FQ 1837

>hg18||uc001ioo
        |10|NM_001081|O60494|CUBN_HUMAN|CUBN|NM_001081|NP_001072|cubilin

          Length = 3623

 Score =  88 bits (217), Expect = 4e-018
 Identities = 58/171 (33%), Positives = 83/171 (48%), Gaps = 15/171 (8%)

Query:   4 QGDGLLCSDIDEC--LSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKD 60
           ||.| .| ||.||   .|  |  |   | || ||  |  |  || |||  |   . |   
Sbjct: 297 QGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVS 356

Query:  61 NGGCHANALCTNREGS-RLRKCKVGFSGDGFECADVNECNNQKICH--WNATCTNNPGSY 117
           ||||| .| |..  ||  |  |  |..|.|.      . .|  . |   |  | .    |
Sbjct: 357 NGGCHPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGY 416

Query: 118 VCTCNAGYKGNGNYLCLD-IDECSETPYLCSSSLGYKGCKNLPGSYRCTCS 167
            | |..|. |     | . |.||   | |   .     | .   |. | |.
Sbjct: 417 FCKCDSGWTGVN---CTENINECLSNPCLNGGT-----CVDGVDSFSCECT 459

>hg18||uc001mqe
        |11|NM_006157|Q92832|NELL1_HUMAN|NELL1|NM_006157|NP_006148|nel-like 1
        precursor

          Length = 810

 Score =  88 bits (216), Expect = 5e-018
 Identities = 49/126 (38%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query:   9 LCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYI---GDGAECQDINECQKDNGGCH 65
           .|   . |  |   |   . | |     .| | ||||   || | |.||.||      ||
Sbjct: 388 VCRGHNFCAEG-PKCGENSECKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCH 446

Query:  66 ANALCTNREGSRLRKCKVGF-SGDGFECADVNEC-NNQKICHWNATCTNNPGSYVCTCNA 123
           || .| |  |     |  |.   | | | . .|| . |  |  || |||    . |||  
Sbjct: 447 ANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKP 506

Query: 124 GYKGNG 129
           || |||
Sbjct: 507 GYVGNG 512

>hg18||uc001mqf
        |11|BC096103|Q4VB91|Q4VB91_HUMAN|NELL1|NM_006157|NP_006148|nel-like 1
        precursor

          Length = 763

 Score =  88 bits (216), Expect = 5e-018
 Identities = 49/126 (38%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query:   9 LCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYI---GDGAECQDINECQKDNGGCH 65
           .|   . |  |   |   . | |     .| | ||||   || | |.||.||      ||
Sbjct: 388 VCRGHNFCAEG-PKCGENSECKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCH 446

Query:  66 ANALCTNREGSRLRKCKVGF-SGDGFECADVNEC-NNQKICHWNATCTNNPGSYVCTCNA 123
           || .| |  |     |  |.   | | | . .|| . |  |  || |||    . |||  
Sbjct: 447 ANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKP 506

Query: 124 GYKGNG 129
           || |||
Sbjct: 507 GYVGNG 512

>hg18||uc001ioo
        |10|NM_001081|O60494|CUBN_HUMAN|CUBN|NM_001081|NP_001072|cubilin

          Length = 3623

 Score =  87 bits (215), Expect = 7e-018
 Identities = 50/124 (40%), Positives = 68/124 (54%), Gaps = 6/124 (4%)

Query:  12 DIDECLSGLHSCHPKARCNNTLGSYSC-FCLSGYIGDGAECQDINECQKDNGGCHA--NA 68
           | |||      |    .| || ||. |  | .|. |.|  |.|||||. .||||      
Sbjct: 263 DRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNGYICEDINECEINNGGCSVAPPV 322

Query:  69 LCTNREG-SRLRKCKVGFSGDGFECADVNECN-NQKICHWNATCTNNPGSY-VCTCNAGY 125
            | |  | |  . |  |. |||  |   . |. .   || .|.|..  ||  .|||  ||
Sbjct: 323 ECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGCHPDASCSSTLGSLPLCTCLPGY 382

Query: 126 KGNG 129
            |||
Sbjct: 383 TGNG 386

>hg18||uc003kuu
        |5|NM_001999|P35556|FBN2_HUMAN|FBN2|NM_001999|NP_001990|fibrillin 2
        precursor

          Length = 2912

 Score =  86 bits (212), Expect = 1e-017
 Identities = 55/150 (36%), Positives = 70/150 (46%), Gaps = 13/150 (8%)

Query:  23 CHPKARCNNTLGSYSCFCLSGYIGDGAECQDINECQKDNGGCHANALCTNREGSRLRKCK 82
           | |    |.    .   | || .|   . .|||||  |   | || .| |  ||    | 
Sbjct: 741 CQPCPAKNS--AEFHGLCSSG-VGITVDGRDINECALDPDIC-ANGICENLRGSYRCNCN 796

Query:  83 VGFSGD--GFECADVNECNNQKICHWNATCTNNPGSYVCTCNAGYK-GNGNYLCLDIDEC 139
            |.  |  |  | |..||   ..   |  | | |||| |||  ||        | ||.||
Sbjct: 797 SGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINEC 856

Query: 140 SETPYLCSSSLGYKGCKNLPGSYRCTCSXG 169
              |  | .      |.|  ||. | || |
Sbjct: 857 ESNP--CVNG----ACRNNLGSFNCECSPG 880

>hg18||uc001mqe
        |11|NM_006157|Q92832|NELL1_HUMAN|NELL1|NM_006157|NP_006148|nel-like 1
        precursor

          Length = 810

 Score =  86 bits (211), Expect = 2e-017
 Identities = 45/126 (35%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query:   4 QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNG 62
           |||   | ||||| . .| ||    | |  | | | |. |||  |   | . .||     
Sbjct: 426 QGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQH 485

Query:  63 GCHANALCTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            |  ||.|||        || |. |.|  |    |    . | .  ||        | | 
Sbjct: 486 NCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCE----EGCRYGGTCV---APNKCVCP 538

Query: 123 AGYKGN 128
           .|. |.
Sbjct: 539 SGFTGS 544

>hg18||uc001mqf
        |11|BC096103|Q4VB91|Q4VB91_HUMAN|NELL1|NM_006157|NP_006148|nel-like 1
        precursor

          Length = 763

 Score =  86 bits (211), Expect = 2e-017
 Identities = 45/126 (35%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query:   4 QGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYSCFCLSGYIG-DGAECQDINECQKDNG 62
           |||   | ||||| . .| ||    | |  | | | |. |||  |   | . .||     
Sbjct: 426 QGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQH 485

Query:  63 GCHANALCTNREGSRLRKCKVGFSGDGFECADVNECNNQKICHWNATCTNNPGSYVCTCN 122
            |  ||.|||        || |. |.|  |    |    . | .  ||        | | 
Sbjct: 486 NCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCE----EGCRYGGTCV---APNKCVCP 538

Query: 123 AGYKGN 128
           .|. |.
Sbjct: 539 SGFTGS 544

>hg18||uc002rzh
        |2|NM_004105|Q12805|FBLN3_HUMAN|EFEMP1|NM_004105|NP_004096|EGF-containi
        ng fibulin-like extracellular matrix

          Length = 493

 Score =  85 bits (208), Expect = 4e-017
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query:  35 SYSCFCLSGY-IGDGAECQDINECQKDNGGCHANALCTNREGSRLRKCKVGFSGDGFECA 93
           |.   | .||   .   ||||.||      | |. .| |  ||   .|  |.   | .| 
Sbjct: 154 SHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCV 213

Query:  94 DVNECNNQKICHWNATCTNNPGSYVCTCNAGYK-GNGNYLCLDIDEC---SETPYLCSSS 149
           |..||     ||    | | |||. | |. |..    || |.||.||   ..    | . 
Sbjct: 214 DIDECTIPPYCH--QRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNI 271

Query: 150 LGYKGCK 156
           ||   |.
Sbjct: 272 LGSFICQ 278

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,183,133
Number of Sequences: 45480
Number of Extensions: 191183133
Number of Successful Extensions: 11127707
Number of sequences better than 0.0: 0
BLASTP 7.6.0