BLASTP 7.6.0


Query=fugu4_747595 |jgi|Takru4|747595|fgh5_pg.C_scaffold_6871000002
        (117 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002shu |2|AK094335|Q9ULR5|Q9ULR5_HUMAN|KIAA1155|NA|NA|KI...     36   0.007
hg18||uc003led |5|NM_016480|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_016480|N...     27   2.652
hg18||uc003lee |5|BC039337|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_016480|NP...     27   2.652
hg18||uc003lef |5|NM_001033112|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_00103...     27   2.652
hg18||uc001yeg |14|NM_024734|Q96JQ2|CLMN_HUMAN|CLMN|NM_024734|NP...     26   7.717

>hg18||uc002shu |2|AK094335|Q9ULR5|Q9ULR5_HUMAN|KIAA1155|NA|NA|KIAA1155 protein
        (Fragment)

          Length = 123

 Score =  36 bits (81), Expect = 0.007
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 74 MLEEEDQDWFIPSRD 88
          ||.||||||||||||
Sbjct: 64 MLDEEDQDWFIPSRD 78

>hg18||uc003led
        |5|NM_016480|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_016480|NP_057564|poly(A)
        binding protein interacting protein 2

          Length = 127

 Score =  27 bits (59), Expect = 2.652
 Identities = 9/13 (69%), Positives = 12/13 (92%)

Query: 76 EEEDQDWFIPSRD 88
          |||. .||||.||
Sbjct: 67 EEEEHEWFIPARD 79

>hg18||uc003lee |5|BC039337|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_016480|NP_057564|poly(A)
        binding protein interacting protein 2

          Length = 127

 Score =  27 bits (59), Expect = 2.652
 Identities = 9/13 (69%), Positives = 12/13 (92%)

Query: 76 EEEDQDWFIPSRD 88
          |||. .||||.||
Sbjct: 67 EEEEHEWFIPARD 79

>hg18||uc003lef
        |5|NM_001033112|Q9BPZ3|PAIP2_HUMAN|PAIP2|NM_001033112|NP_001028284|poly
        (A) binding protein interacting protein 2

          Length = 127

 Score =  27 bits (59), Expect = 2.652
 Identities = 9/13 (69%), Positives = 12/13 (92%)

Query: 76 EEEDQDWFIPSRD 88
          |||. .||||.||
Sbjct: 67 EEEEHEWFIPARD 79

>hg18||uc001yeg
        |14|NM_024734|Q96JQ2|CLMN_HUMAN|CLMN|NM_024734|NP_079010|calponin like
        transmembrane domain protein

          Length = 1002

 Score =  26 bits (55), Expect = 7.717
 Identities = 13/40 (32%), Positives = 17/40 (42%)

Query:  75 LEEEDQDWFIPSRDXXXXXXXXXXXXXXXXSVSDHHSNLE 114
           |||.  |. ||||                 | ||| | ..
Sbjct: 891 LEEDSSDYSIPSRTSHSDSSIYLRRHTHRSSESDHFSYVQ 930

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0