BLASTP 7.6.0


Query=fugu4_747498 |jgi|Takru4|747498|fgh5_pg.C_scaffold_6253000001
        (436 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001mqd |11|NM_004211|Q4VAM7|Q4VAM7_HUMAN|SLC6A5|NM_00421...    300   4e-081
hg18||uc001mqd |11|NM_004211|Q4VAM7|Q4VAM7_HUMAN|SLC6A5|NM_00421...    223   6e-058
hg18||uc004eqi |X|NM_007231|Q9UN76|S6A14_HUMAN|SLC6A14|NM_007231...    198   1e-050
hg18||uc001cll |1|NM_201649|Q5TAB9|Q5TAB9_HUMAN|SLC6A9|NM_201649...    195   1e-049
hg18||uc001clm |1|NM_006934|Q5TAC0|Q5TAC0_HUMAN|SLC6A9|NM_006934...    195   1e-049
hg18||uc001cln |1|NM_001024845|Q5TAB8|Q5TAB8_HUMAN|SLC6A9|NM_001...    195   1e-049
hg18||uc003lrr |5|NM_014228|Q99884|SC6A7_HUMAN|SLC6A7|NM_014228|...    189   9e-048
hg18||uc001cll |1|NM_201649|Q5TAB9|Q5TAB9_HUMAN|SLC6A9|NM_201649...    182   1e-045
hg18||uc001clm |1|NM_006934|Q5TAC0|Q5TAC0_HUMAN|SLC6A9|NM_006934...    182   1e-045
hg18||uc001cln |1|NM_001024845|Q5TAB8|Q5TAB8_HUMAN|SLC6A9|NM_001...    182   1e-045
hg18||uc001qhz |12|NM_003044|A0AV52|A0AV52_HUMAN|SLC6A12|NM_0030...    176   8e-044
hg18||uc001qia |12|BC026339|A0AV52|A0AV52_HUMAN|SLC6A12|NM_00304...    176   8e-044
hg18||uc001qib |12|AK125026|A0AV52|A0AV52_HUMAN|SLC6A12|NM_00304...    176   8e-044
hg18||uc001qic |12|NM_016615|Q8TCC2|Q8TCC2_HUMAN|SLC6A13|NM_0166...    170   4e-042
hg18||uc003jck |5|NM_001044|Q01959|SC6A3_HUMAN|SLC6A3|NM_001044|...    169   1e-041
hg18||uc002eif |16|M65105|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP...    166   5e-041
hg18||uc002eig |16|BC060831|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|...    166   5e-041
hg18||uc002eih |16|NM_001043|P23975|SC6A2_HUMAN|SLC6A2|NM_001043...    166   5e-041
hg18||uc003bwa |3|NM_003042|Q8N4K8|Q8N4K8_HUMAN|SLC6A1|NM_003042...    165   1e-040
hg18||uc002hey |17|NM_001045|P31645|SC6A4_HUMAN|SLC6A4|NM_001045...    165   1e-040
hg18||uc003byq |3|NM_003043|P31641|SC6A6_HUMAN|SLC6A6|NM_003043|...    165   1e-040
hg18||uc003byp |3|BC006252|Q9BRI2|Q9BRI2_HUMAN|SLC6A6|NM_003043|...    163   4e-040
hg18||uc004fib |X|NM_005629|P48029|SC6A8_HUMAN|SLC6A8|NM_005629|...    163   4e-040
hg18||uc003bwa |3|NM_003042|Q8N4K8|Q8N4K8_HUMAN|SLC6A1|NM_003042...    162   9e-040
hg18||uc003lrr |5|NM_014228|Q99884|SC6A7_HUMAN|SLC6A7|NM_014228|...    160   3e-039
hg18||uc003bvz |3|NM_014229|P48066|S6A11_HUMAN|SLC6A11|NM_014229...    160   5e-039
hg18||uc003bvy |3|BC036083|Q8IYC9|Q8IYC9_HUMAN|SLC6A11|NA|NA|SLC...    159   8e-039
hg18||uc001qhz |12|NM_003044|A0AV52|A0AV52_HUMAN|SLC6A12|NM_0030...    158   1e-038
hg18||uc001qia |12|BC026339|A0AV52|A0AV52_HUMAN|SLC6A12|NM_00304...    158   1e-038
hg18||uc001qib |12|AK125026|A0AV52|A0AV52_HUMAN|SLC6A12|NM_00304...    158   1e-038
hg18||uc004fib |X|NM_005629|P48029|SC6A8_HUMAN|SLC6A8|NM_005629|...    158   2e-038
hg18||uc004fic |X|AB209704|Q59EV7|Q59EV7_HUMAN|SLC6A8|NM_005629|...    158   2e-038
hg18||uc004eqi |X|NM_007231|Q9UN76|S6A14_HUMAN|SLC6A14|NM_007231...    156   9e-038
hg18||uc003bvz |3|NM_014229|P48066|S6A11_HUMAN|SLC6A11|NM_014229...    151   2e-036
hg18||uc001qic |12|NM_016615|Q8TCC2|Q8TCC2_HUMAN|SLC6A13|NM_0166...    151   3e-036
hg18||uc001szv |12|NM_182767|Q9H2J7|S6A15_HUMAN|SLC6A15|NM_18276...    144   3e-034
hg18||uc001szy |12|NM_018057|Q9H9F5|Q9H9F5_HUMAN|SLC6A15|NM_0180...    144   3e-034
hg18||uc002eif |16|M65105|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP...    142   1e-033
hg18||uc002eig |16|BC060831|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|...    142   1e-033
hg18||uc002eih |16|NM_001043|P23975|SC6A2_HUMAN|SLC6A2|NM_001043...    142   1e-033
hg18||uc002eii |16|BC039309|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|...    142   1e-033
hg18||uc002hey |17|NM_001045|P31645|SC6A4_HUMAN|SLC6A4|NM_001045...    141   2e-033
hg18||uc003jby |5|NM_182632|Q96N87|S6A18_HUMAN|SLC6A18|NM_182632...    141   2e-033
hg18||uc003jck |5|NM_001044|Q01959|SC6A3_HUMAN|SLC6A3|NM_001044|...    140   4e-033
hg18||uc003jbw |5|NM_001003841|Q695T7|S6A19_HUMAN|SLC6A19|NM_001...    139   1e-032
hg18||uc001dzd |1|NM_001010898|Q9H1V8|S6A17_HUMAN|SLC6A17|NM_001...    138   1e-032
hg18||uc003cou |3|NM_020208|Q9NP91|S6A20_HUMAN|SLC6A20|NM_020208...    138   2e-032
hg18||uc003cov |3|NM_022405|Q9NP91-2|Q9NP91-2|SLC6A20|NM_022405|...    138   2e-032
hg18||uc003byq |3|NM_003043|P31641|SC6A6_HUMAN|SLC6A6|NM_003043|...    135   1e-031
hg18||uc003jby |5|NM_182632|Q96N87|S6A18_HUMAN|SLC6A18|NM_182632...    129   1e-029
hg18||uc003cou |3|NM_020208|Q9NP91|S6A20_HUMAN|SLC6A20|NM_020208...    126   7e-029
hg18||uc001dzd |1|NM_001010898|Q9H1V8|S6A17_HUMAN|SLC6A17|NM_001...    124   4e-028
hg18||uc003jbw |5|NM_001003841|Q695T7|S6A19_HUMAN|SLC6A19|NM_001...    124   4e-028
hg18||uc001szv |12|NM_182767|Q9H2J7|S6A15_HUMAN|SLC6A15|NM_18276...    121   3e-027
hg18||uc004fic |X|AB209704|Q59EV7|Q59EV7_HUMAN|SLC6A8|NM_005629|...    119   7e-027
hg18||uc002eij |16|BC000563|Q9BW84|Q9BW84_HUMAN|SLC6A2|NM_001043...    103   5e-022
hg18||uc003cov |3|NM_022405|Q9NP91-2|Q9NP91-2|SLC6A20|NM_022405|...     77   3e-014
hg18||uc001szw |12|AF351619|NA|NA|SLC6A15|NA|NA|Homo sapiens orp...     77   4e-014
hg18||uc001qid |12|AF462445|Q8WW56|Q8WW56_HUMAN|SLC6A13|NA|NA|SL...     70   5e-012
hg18||uc002eii |16|BC039309|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|...     66   7e-011
hg18||uc004fic |X|AB209704|Q59EV7|Q59EV7_HUMAN|SLC6A8|NM_005629|...     41   0.002
hg18||uc003wfl |7|NM_170686|Q8TD17|ZN398_HUMAN|ZNF398|NM_170686|...     29   9.243

>hg18||uc001mqd
        |11|NM_004211|Q4VAM7|Q4VAM7_HUMAN|SLC6A5|NM_004211|NP_004202|solute
        carrier family 6 (neurotransmitter

          Length = 797

 Score =  300 bits (766), Expect = 4e-081
 Identities = 148/209 (70%), Positives = 169/209 (80%), Gaps = 5/209 (2%)

Query: 120 RATAEQNNT-AGNWTAMSQTTIILGTDGNTSVQPGTV-TASDDDDEGGDENKARGNWSNK 177
           . | |.|||    |  |||.|..| ||| ||| ||.| | .  .|| |||||||||||.|
Sbjct: 138 KGTLERNNTPVVGWVNMSQSTVVLATDGITSVLPGSVATVATQEDEQGDENKARGNWSSK 197

Query: 178 MDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQ 237
           .|||||||||||||||||||||||||||||||||||| || .||.||| |||||||||||
Sbjct: 198 LDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQ 257

Query: 238 GPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNDWNT 297
           ||||||| |||||||||||||||||||||||.|.|.||.|||||    ||| .| | |||
Sbjct: 258 GPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNT 317

Query: 298 VECKDKDMLLLG---VSDYAWVVYFTATF 323
            |||||  |||    .||.  .    .||
Sbjct: 318 PECKDKTKLLLDSCVISDHPKIQIKNSTF 346

>hg18||uc001mqd
        |11|NM_004211|Q4VAM7|Q4VAM7_HUMAN|SLC6A5|NM_004211|NP_004202|solute
        carrier family 6 (neurotransmitter

          Length = 797

 Score =  223 bits (566), Expect = 6e-058
 Identities = 111/131 (84%), Positives = 116/131 (88%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           |  |.     |||||||||||||.||||||||||||  || |||||||||| || |||||
Sbjct: 411 LAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDA 470

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHE 425
           ||||||||||||||||||||||||||||||||.|||||||||||||||||||||||||.|
Sbjct: 471 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANE 530

Query: 426 LKVPIEKVADE 436
            || || |||.
Sbjct: 531 RKVNIENVADQ 541

>hg18||uc004eqi
        |X|NM_007231|Q9UN76|S6A14_HUMAN|SLC6A14|NM_007231|NP_009162|solute
        carrier family 6 (amino acid

          Length = 642

 Score =  198 bits (503), Expect = 1e-050
 Identities = 89/148 (60%), Positives = 114/148 (77%), Gaps = 3/148 (2%)

Query: 155 VTASDDDDEGG--DENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIP 212
           |.|| ..   |  |||. ||||| | |..|||.||||||||||||||| . |||||||||
Sbjct:  18 VSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVWRFPYLTYSNGGGAFLIP 77

Query: 213 YLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMC 272
           |  || .||.|.| || ||||||| ||||||. .|  || || |..||. . ||||.|. 
Sbjct:  78 YAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGITMVLISIFVTIYYNVIIA 137

Query: 273 WTLYYLFASLKGSLPWANCRNDWNTVEC 300
           ..|||.||| .  ||| || . |.   |
Sbjct: 138 YSLYYMFASFQSELPWKNC-SSWSDKNC 164

>hg18||uc001cll
        |1|NM_201649|Q5TAB9|Q5TAB9_HUMAN|SLC6A9|NM_201649|NP_964012|solute
        carrier family 6 member 9 isoform 2

          Length = 706

 Score =  195 bits (494), Expect = 1e-049
 Identities = 88/130 (67%), Positives = 111/130 (85%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           |. ||     ||||||||||||| || .||||| ||||||.|..||.|.|. .|||| ||
Sbjct: 305 LIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDA 364

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHE 425
           |.|||.||  |||||||..||||||||||||.||.. || |||..|||||||..||||. 
Sbjct: 365 ASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANH 424

Query: 426 LKVPIEKVAD 435
           | | . .|||
Sbjct: 425 LGVDVSRVAD 434

>hg18||uc001clm
        |1|NM_006934|Q5TAC0|Q5TAC0_HUMAN|SLC6A9|NM_006934|NP_008865|solute
        carrier family 6 member 9 isoform 1

          Length = 652

 Score =  195 bits (494), Expect = 1e-049
 Identities = 88/130 (67%), Positives = 111/130 (85%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           |. ||     ||||||||||||| || .||||| ||||||.|..||.|.|. .|||| ||
Sbjct: 251 LIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDA 310

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHE 425
           |.|||.||  |||||||..||||||||||||.||.. || |||..|||||||..||||. 
Sbjct: 311 ASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANH 370

Query: 426 LKVPIEKVAD 435
           | | . .|||
Sbjct: 371 LGVDVSRVAD 380

>hg18||uc001cln
        |1|NM_001024845|Q5TAB8|Q5TAB8_HUMAN|SLC6A9|NM_001024845|NP_001020016|so
        lute carrier family 6 member 9 isoform 3

          Length = 633

 Score =  195 bits (494), Expect = 1e-049
 Identities = 88/130 (67%), Positives = 111/130 (85%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           |. ||     ||||||||||||| || .||||| ||||||.|..||.|.|. .|||| ||
Sbjct: 232 LIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDA 291

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHE 425
           |.|||.||  |||||||..||||||||||||.||.. || |||..|||||||..||||. 
Sbjct: 292 ASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANH 351

Query: 426 LKVPIEKVAD 435
           | | . .|||
Sbjct: 352 LGVDVSRVAD 361

>hg18||uc003lrr
        |5|NM_014228|Q99884|SC6A7_HUMAN|SLC6A7|NM_014228|NP_055043|solute
        carrier family 6, member 7

          Length = 636

 Score =  189 bits (478), Expect = 9e-048
 Identities = 88/148 (59%), Positives = 109/148 (73%), Gaps = 2/148 (1%)

Query: 155 VTASDDDDEGGDENKA--RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIP 212
           .| ||  |   | . |  ||||. |.||.|| .|| ||||||||||| |. |||||||.|
Sbjct:  19 MTPSDQGDVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVP 78

Query: 213 YLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMC 272
           |  || | |||.| ||.|||||.| ||..|||  |  .| | |||.|  |.|||||.|. 
Sbjct:  79 YFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIA 138

Query: 273 WTLYYLFASLKGSLPWANCRNDWNTVEC 300
           . |.||||||   ||| .| | |||  |
Sbjct: 139 YVLFYLFASLTSDLPWEHCGNWWNTELC 166

>hg18||uc001cll
        |1|NM_201649|Q5TAB9|Q5TAB9_HUMAN|SLC6A9|NM_201649|NP_964012|solute
        carrier family 6 member 9 isoform 2

          Length = 706

 Score =  182 bits (460), Expect = 1e-045
 Identities = 75/135 (55%), Positives = 99/135 (73%)

Query: 166 DENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIF 225
           |.|  |||| |...|.|. |||||||||||||||| ..||||||. ||  ||   |||.|
Sbjct:  95 DQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLF 154

Query: 226 LLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGS 285
            .|.| ||||||| . ||.  |  .| |  |...|  | ||||...|   || |.|.   
Sbjct: 155 FMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHV 214

Query: 286 LPWANCRNDWNTVEC 300
           |||| | | ||| .|
Sbjct: 215 LPWAYCNNPWNTHDC 229

>hg18||uc001clm
        |1|NM_006934|Q5TAC0|Q5TAC0_HUMAN|SLC6A9|NM_006934|NP_008865|solute
        carrier family 6 member 9 isoform 1

          Length = 652

 Score =  182 bits (460), Expect = 1e-045
 Identities = 75/135 (55%), Positives = 99/135 (73%)

Query: 166 DENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIF 225
           |.|  |||| |...|.|. |||||||||||||||| ..||||||. ||  ||   |||.|
Sbjct:  41 DQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLF 100

Query: 226 LLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGS 285
            .|.| ||||||| . ||.  |  .| |  |...|  | ||||...|   || |.|.   
Sbjct: 101 FMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHV 160

Query: 286 LPWANCRNDWNTVEC 300
           |||| | | ||| .|
Sbjct: 161 LPWAYCNNPWNTHDC 175

>hg18||uc001cln
        |1|NM_001024845|Q5TAB8|Q5TAB8_HUMAN|SLC6A9|NM_001024845|NP_001020016|so
        lute carrier family 6 member 9 isoform 3

          Length = 633

 Score =  182 bits (460), Expect = 1e-045
 Identities = 75/135 (55%), Positives = 99/135 (73%)

Query: 166 DENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIF 225
           |.|  |||| |...|.|. |||||||||||||||| ..||||||. ||  ||   |||.|
Sbjct:  22 DQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLF 81

Query: 226 LLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGS 285
            .|.| ||||||| . ||.  |  .| |  |...|  | ||||...|   || |.|.   
Sbjct:  82 FMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHV 141

Query: 286 LPWANCRNDWNTVEC 300
           |||| | | ||| .|
Sbjct: 142 LPWAYCNNPWNTHDC 156

>hg18||uc001qhz
        |12|NM_003044|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  176 bits (444), Expect = 8e-044
 Identities = 76/143 (53%), Positives = 97/143 (67%), Gaps = 1/143 (0%)

Query: 161 DDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIA 220
           | |  |. | || |.|||.|.||. |  .||||||||||| ..|||||| |||     . 
Sbjct:  26 DQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVC 85

Query: 221 GIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLF 279
           |||.| |||.|||. ||| |. | |  |  || |.| ..|   . .|| ||. | |.|||
Sbjct:  86 GIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLF 145

Query: 280 ASLKGSLPWANCRNDWNTVECKD 302
           .|    |||  | | |||  | |
Sbjct: 146 SSFTSELPWTTCNNFWNTEHCTD 168

>hg18||uc001qia
        |12|BC026339|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  176 bits (444), Expect = 8e-044
 Identities = 76/143 (53%), Positives = 97/143 (67%), Gaps = 1/143 (0%)

Query: 161 DDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIA 220
           | |  |. | || |.|||.|.||. |  .||||||||||| ..|||||| |||     . 
Sbjct:  26 DQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVC 85

Query: 221 GIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLF 279
           |||.| |||.|||. ||| |. | |  |  || |.| ..|   . .|| ||. | |.|||
Sbjct:  86 GIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLF 145

Query: 280 ASLKGSLPWANCRNDWNTVECKD 302
           .|    |||  | | |||  | |
Sbjct: 146 SSFTSELPWTTCNNFWNTEHCTD 168

>hg18||uc001qib
        |12|AK125026|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  176 bits (444), Expect = 8e-044
 Identities = 76/143 (53%), Positives = 97/143 (67%), Gaps = 1/143 (0%)

Query: 161 DDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIA 220
           | |  |. | || |.|||.|.||. |  .||||||||||| ..|||||| |||     . 
Sbjct:  26 DQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVC 85

Query: 221 GIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLF 279
           |||.| |||.|||. ||| |. | |  |  || |.| ..|   . .|| ||. | |.|||
Sbjct:  86 GIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLF 145

Query: 280 ASLKGSLPWANCRNDWNTVECKD 302
           .|    |||  | | |||  | |
Sbjct: 146 SSFTSELPWTTCNNFWNTEHCTD 168

>hg18||uc001qic
        |12|NM_016615|Q8TCC2|Q8TCC2_HUMAN|SLC6A13|NM_016615|NP_057699|solute
        carrier family 6 (neurotransmitter

          Length = 602

 Score =  170 bits (429), Expect = 4e-042
 Identities = 77/163 (47%), Positives = 106/163 (65%), Gaps = 4/163 (2%)

Query: 141 ILGTDGNTSVQPGTVTASDDDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYL 200
           . ||  |   .|        ...|  |   ||.|.|||.|.||. |  .|||||||||||
Sbjct:   5 VSGTTSNGETKPVYPVMEKKEEDGTLE---RGHWNNKMEFVLSVAGEIIGLGNVWRFPYL 61

Query: 201 AFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLII 259
            ..|||||| ||||  |   |||.|||| .|||. ||| |. | |  |  .| | |  .|
Sbjct:  62 CYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQMI 121

Query: 260 SVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNDWNTVECKD 302
            .|. .|| |.. | |.|||.|    |||  | ..|||  | .
Sbjct: 122 VILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCME 164

>hg18||uc003jck
        |5|NM_001044|Q01959|SC6A3_HUMAN|SLC6A3|NM_001044|NP_001035|solute
        carrier family 6 (neurotransmitter

          Length = 620

 Score =  169 bits (426), Expect = 1e-041
 Identities = 68/136 (50%), Positives = 97/136 (71%)

Query: 167 ENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFL 226
           | . |  |  |.||.||..|.|| | |||||||| ..|||||||.|||  . |||.|.| 
Sbjct:  56 EAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFY 115

Query: 227 LEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSL 286
           .|..||||  .|   |||  | |.| |  ...||. .  .||.|. | |.|||.|    |
Sbjct: 116 MELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTEL 175

Query: 287 PWANCRNDWNTVECKD 302
           || .| | ||.  | |
Sbjct: 176 PWIHCNNSWNSPNCSD 191

>hg18||uc002eif |16|M65105|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  166 bits (420), Expect = 5e-041
 Identities = 69/136 (50%), Positives = 99/136 (72%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |  |.||.||.||.|| | |||||||| ..||||||||||   | |||.|.| .|..
Sbjct:  56 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELA 115

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           |||.  .|  .|||  |  .| | |...|.. .  |||.|. |.|||||.|   .||| .
Sbjct: 116 LGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTD 175

Query: 291 CRNDWNTVECKDKDML 306
           | . ||.  | |  .|
Sbjct: 176 CGHTWNSPNCTDPKLL 191

>hg18||uc002eig
        |16|BC060831|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  166 bits (420), Expect = 5e-041
 Identities = 69/136 (50%), Positives = 99/136 (72%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |  |.||.||.||.|| | |||||||| ..||||||||||   | |||.|.| .|..
Sbjct:  56 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELA 115

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           |||.  .|  .|||  |  .| | |...|.. .  |||.|. |.|||||.|   .||| .
Sbjct: 116 LGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTD 175

Query: 291 CRNDWNTVECKDKDML 306
           | . ||.  | |  .|
Sbjct: 176 CGHTWNSPNCTDPKLL 191

>hg18||uc002eih
        |16|NM_001043|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  166 bits (420), Expect = 5e-041
 Identities = 69/136 (50%), Positives = 99/136 (72%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |  |.||.||.||.|| | |||||||| ..||||||||||   | |||.|.| .|..
Sbjct:  56 RETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELA 115

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           |||.  .|  .|||  |  .| | |...|.. .  |||.|. |.|||||.|   .||| .
Sbjct: 116 LGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTD 175

Query: 291 CRNDWNTVECKDKDML 306
           | . ||.  | |  .|
Sbjct: 176 CGHTWNSPNCTDPKLL 191

>hg18||uc003bwa
        |3|NM_003042|Q8N4K8|Q8N4K8_HUMAN|SLC6A1|NM_003042|NP_003033|solute
        carrier family 6 (neurotransmitter

          Length = 599

 Score =  165 bits (417), Expect = 1e-040
 Identities = 80/126 (63%), Positives = 96/126 (76%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||||.||.||..||||  |||||||| .|||..||| . ||.|..|| |||||
Sbjct: 232 GVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQ 291

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           ||||     | || | ||| |||| |||..|| | || ||.||||||||..|||||  | 
Sbjct: 292 IFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKR 351

Query: 429 PIEKVA 434
            |  ||
Sbjct: 352 SIADVA 357

>hg18||uc002hey
        |17|NM_001045|P31645|SC6A4_HUMAN|SLC6A4|NM_001045|NP_001036|solute
        carrier family 6 member 4

          Length = 630

 Score =  165 bits (416), Expect = 1e-040
 Identities = 77/159 (48%), Positives = 100/159 (62%), Gaps = 6/159 (3%)

Query: 143 GTDGNTSVQPGTVTASDDDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAF 202
           | |   |.   | |   .  .|      |  |  |.||.||..|||| |||||||||. .
Sbjct:  56 GDDTRHSIPATTTTLVAELHQG-----ERETWGKKVDFLLSVIGYAVDLGNVWRFPYICY 110

Query: 203 QNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISV 261
           ||||||||.||  |    |||.| .|..|||.   | .|.| |  |  .| | |. ||. 
Sbjct: 111 QNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAF 170

Query: 262 LIAIYYNIIMCWTLYYLFASLKGSLPWANCRNDWNTVEC 300
            || ||| || | |||| .|    ||| .|.| |||  |
Sbjct: 171 YIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNC 209

>hg18||uc003byq
        |3|NM_003043|P31641|SC6A6_HUMAN|SLC6A6|NM_003043|NP_003034|solute
        carrier family 6 (neurotransmitter

          Length = 620

 Score =  165 bits (416), Expect = 1e-040
 Identities = 79/197 (40%), Positives = 115/197 (58%), Gaps = 10/197 (5%)

Query: 152 PGTVTASDDDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLI 211
           ||    .  .||   .   |  ||.|.||.||. |  |||||||||||| ..||||||||
Sbjct:  22 PGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLI 81

Query: 212 PYLTMLGIAGIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNII 270
           ||   |  .|.|.| ||. .||. |.| .. | |  |   | | | ..|  |. .|| .|
Sbjct:  82 PYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIVI 141

Query: 271 MCWTLYYLFASLKGSLPWANCRNDWNTVECKDKDMLLLGVSDYAWVVYFTATFPYVVL-- 328
           . |  |||| | .  ||||.| . |||  | .  |     .   |.   .  |   |.  
Sbjct: 142 LAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTM---RKNKSVWITISSTNFTSPVIEF 198

Query: 329 ----IILLIRGVTLPGA 341
               .. |  |.  ||.
Sbjct: 199 WERNVLSLSPGIDHPGS 215

>hg18||uc003byp
        |3|BC006252|Q9BRI2|Q9BRI2_HUMAN|SLC6A6|NM_003043|NP_003034|solute
        carrier family 6 (neurotransmitter

          Length = 200

 Score =  163 bits (412), Expect = 4e-040
 Identities = 72/155 (46%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 152 PGTVTASDDDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLI 211
           ||    .  .||   .   |  ||.|.||.||. |  |||||||||||| ..||||||||
Sbjct:  22 PGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYLCYKNGGGAFLI 81

Query: 212 PYLTMLGIAGIPIFLLEVSLGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNII 270
           ||   |  .|.|.| ||. .||. |.| .. | |  |   | | | ..|  |. .|| .|
Sbjct:  82 PYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIVI 141

Query: 271 MCWTLYYLFASLKGSLPWANCRNDWNTVECKDKDM 305
           . |  |||| | .  ||||.| . |||  | .  |
Sbjct: 142 LAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTM 176

>hg18||uc004fib
        |X|NM_005629|P48029|SC6A8_HUMAN|SLC6A8|NM_005629|NP_005620|solute
        carrier family 6 (neurotransmitter

          Length = 635

 Score =  163 bits (412), Expect = 4e-040
 Identities = 75/127 (59%), Positives = 93/127 (73%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     .||||||||||||..||.||| |||| |||.|.. | | ||   .|| || ||
Sbjct: 253 GVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKLGSPQVWIDAGTQ 312

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | |||.|.||||.| .|.   || || |||||.||..|||| |  |
Sbjct: 313 IFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVFSILGFMAAEQGV 372

Query: 429 PIEKVAD 435
            | |||.
Sbjct: 373 HISKVAE 379

>hg18||uc003bwa
        |3|NM_003042|Q8N4K8|Q8N4K8_HUMAN|SLC6A1|NM_003042|NP_003033|solute
        carrier family 6 (neurotransmitter

          Length = 599

 Score =  162 bits (409), Expect = 9e-040
 Identities = 70/130 (53%), Positives = 89/130 (68%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |  . ||..| ||||.|||||||||||  .||||||||||   |  ||.|.|||| |
Sbjct:  44 RDTWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECS 103

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           |||. | | . |||  |  .| |.|  ..|  . ||| .|. | .|||. |   .|||  
Sbjct: 104 LGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQ 163

Query: 291 CRNDWNTVEC 300
           | | |||  |
Sbjct: 164 CDNPWNTDRC 173

>hg18||uc003lrr
        |5|NM_014228|Q99884|SC6A7_HUMAN|SLC6A7|NM_014228|NP_055043|solute
        carrier family 6, member 7

          Length = 636

 Score =  160 bits (404), Expect = 3e-039
 Identities = 75/129 (58%), Positives = 100/129 (77%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           .| ||     ||||||||||..|..||.||||||||. || ...||..  |  .||| .|
Sbjct: 232 ILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEA 291

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHE 425
           | |||.||   .|||.| .||| || | |||| |||  |. ||| ||| ||||.|.|. |
Sbjct: 292 ALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQE 351

Query: 426 LKVPIEKVA 434
           | ||...||
Sbjct: 352 LGVPVDQVA 360

>hg18||uc003bvz
        |3|NM_014229|P48066|S6A11_HUMAN|SLC6A11|NM_014229|NP_055044|solute
        carrier family 6 (neurotransmitter

          Length = 632

 Score =  160 bits (403), Expect = 5e-039
 Identities = 78/185 (42%), Positives = 111/185 (60%), Gaps = 8/185 (4%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           ||.|.||..|.||. |  .||||||||||| ..||||||||||.      |||.| || .
Sbjct:  50 RGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETA 109

Query: 231 LGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWA 289
           |||| |.| .. | |  |  .| | |  .|   . .|| ||. | ..||       ||||
Sbjct: 110 LGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWA 169

Query: 290 NCRNDWNTVECKDKDMLLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFI 349
            | ..|||  |   .   | ||.|. |    || | .      .  ..     ||| .  
Sbjct: 170 TCGHEWNTENC--VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAIS-----DGIEHIG 222

Query: 350 TPKWE 354
             .||
Sbjct: 223 NLRWE 227

>hg18||uc003bvy |3|BC036083|Q8IYC9|Q8IYC9_HUMAN|SLC6A11|NA|NA|SLC6A11 protein

          Length = 208

 Score =  159 bits (401), Expect = 8e-039
 Identities = 73/155 (47%), Positives = 100/155 (64%), Gaps = 3/155 (1%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           ||.|.||..|.||. |  .||||||||||| ..||||||||||.      |||.| || .
Sbjct:  50 RGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETA 109

Query: 231 LGQFASQGPVSVW-KCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWA 289
           |||| |.| .. | |  |  .| | |  .|   . .|| ||. | ..||       ||||
Sbjct: 110 LGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWA 169

Query: 290 NCRNDWNTVECKDKDMLLLGVSDYAWVVYFTATFP 324
            | ..|||  |   .   | ||.|. |    || |
Sbjct: 170 TCGHEWNTENC--VEFQKLNVSNYSHVSLQNATSP 202

>hg18||uc001qhz
        |12|NM_003044|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  158 bits (399), Expect = 1e-038
 Identities = 74/127 (58%), Positives = 94/127 (74%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||||||||||..|.||||||||||||. ||.|.. |   .| | .|| || ||
Sbjct: 231 GVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQ 290

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | ||||.|||||.| . .   |||||  ||||.||..|||. |  |
Sbjct: 291 IFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGV 350

Query: 429 PIEKVAD 435
           || .||.
Sbjct: 351 PISEVAE 357

>hg18||uc001qia
        |12|BC026339|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  158 bits (399), Expect = 1e-038
 Identities = 74/127 (58%), Positives = 94/127 (74%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||||||||||..|.||||||||||||. ||.|.. |   .| | .|| || ||
Sbjct: 231 GVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQ 290

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | ||||.|||||.| . .   |||||  ||||.||..|||. |  |
Sbjct: 291 IFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGV 350

Query: 429 PIEKVAD 435
           || .||.
Sbjct: 351 PISEVAE 357

>hg18||uc001qib
        |12|AK125026|A0AV52|A0AV52_HUMAN|SLC6A12|NM_003044|NP_003035|solute
        carrier family 6 (neurotransmitter

          Length = 614

 Score =  158 bits (399), Expect = 1e-038
 Identities = 74/127 (58%), Positives = 94/127 (74%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||||||||||..|.||||||||||||. ||.|.. |   .| | .|| || ||
Sbjct: 231 GVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQ 290

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | ||||.|||||.| . .   |||||  ||||.||..|||. |  |
Sbjct: 291 IFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGV 350

Query: 429 PIEKVAD 435
           || .||.
Sbjct: 351 PISEVAE 357

>hg18||uc004fib
        |X|NM_005629|P48029|SC6A8_HUMAN|SLC6A8|NM_005629|NP_005620|solute
        carrier family 6 (neurotransmitter

          Length = 635

 Score =  158 bits (397), Expect = 2e-038
 Identities = 67/130 (51%), Positives = 88/130 (67%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |. .||||.| ||.||||||||||||| ..|||| |||||. .  . ||||| ||.|
Sbjct:  52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEIS 111

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           ||||   | ..||   |  .| | | ..|      || ... |  |||  |   .|||| 
Sbjct: 112 LGQFMKAGSINVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWAT 171

Query: 291 CRNDWNTVEC 300
           | . ||| .|
Sbjct: 172 CGHTWNTPDC 181

>hg18||uc004fic
        |X|AB209704|Q59EV7|Q59EV7_HUMAN|SLC6A8|NM_005629|NP_005620|solute
        carrier family 6 (neurotransmitter

          Length = 625

 Score =  158 bits (397), Expect = 2e-038
 Identities = 67/130 (51%), Positives = 88/130 (67%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |. .||||.| ||.||||||||||||| ..|||| |||||. .  . ||||| ||.|
Sbjct:  52 RETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEIS 111

Query: 231 LGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWAN 290
           ||||   | ..||   |  .| | | ..|      || ... |  |||  |   .|||| 
Sbjct: 112 LGQFMKAGSINVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWAT 171

Query: 291 CRNDWNTVEC 300
           | . ||| .|
Sbjct: 172 CGHTWNTPDC 181

>hg18||uc004eqi
        |X|NM_007231|Q9UN76|S6A14_HUMAN|SLC6A14|NM_007231|NP_009162|solute
        carrier family 6 (amino acid

          Length = 642

 Score =  156 bits (392), Expect = 9e-038
 Identities = 75/121 (61%), Positives = 90/121 (74%), Gaps = 2/121 (1%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFI--TPKWEKLNDAKVWK 363
           |  |.     |||||| ||||||.|||.|| || ||  || |.|     . || .|.|||
Sbjct: 254 LFKGIKSSGKVVYFTALFPYVVLLILLVRGATLEGASKGISYYIGAQSNFTKLKEAEVWK 313

Query: 364 DAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMA 423
           |||||||.||| |||||. ||||||| |||. | ..|  ||  ||.|||| |||..| ||
Sbjct: 314 DAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVVCLTNCLTSVFAGFAIFSILGHMA 373

Query: 424 H 424
           |
Sbjct: 374 H 374

>hg18||uc003bvz
        |3|NM_014229|P48066|S6A11_HUMAN|SLC6A11|NM_014229|NP_055044|solute
        carrier family 6 (neurotransmitter

          Length = 632

 Score =  151 bits (381), Expect = 2e-036
 Identities = 72/127 (56%), Positives = 92/127 (72%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           |      ||| ||||||..|.|||||||||||| .|| ... |   .|.| .|| || ||
Sbjct: 246 GTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQ 305

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | ||| ..|||||| ... | || ||  ||| ||||.||||.|  |
Sbjct: 306 IFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGV 365

Query: 429 PIEKVAD 435
           || .||.
Sbjct: 366 PIAEVAE 372

>hg18||uc001qic
        |12|NM_016615|Q8TCC2|Q8TCC2_HUMAN|SLC6A13|NM_016615|NP_057699|solute
        carrier family 6 (neurotransmitter

          Length = 602

 Score =  151 bits (379), Expect = 3e-036
 Identities = 72/127 (56%), Positives = 90/127 (70%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||||||||||..|..|||||||||||  || ... |   .| | .|| || ||
Sbjct: 226 GVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQ 285

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | |  | ||||.||||||| . .   || ||  ||| |||..|||. |  |
Sbjct: 286 IFFSFAICLGCLTALGSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGV 345

Query: 429 PIEKVAD 435
           || .||.
Sbjct: 346 PISEVAE 352

>hg18||uc001szv
        |12|NM_182767|Q9H2J7|S6A15_HUMAN|SLC6A15|NM_182767|NP_877499|solute
        carrier family 6, member 15 isoform 1

          Length = 730

 Score =  144 bits (361), Expect = 3e-034
 Identities = 63/133 (47%), Positives = 91/133 (68%), Gaps = 1/133 (0%)

Query: 160 DDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGI 219
           | .|| .    |  |..|. .||. ||..||||||||||||  .|||||.|.||| .| .
Sbjct:  50 DVEEGSEVEDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMV 109

Query: 220 AGIPIFLLEVSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYL 278
            |||.| ||.|.||   .| . ||  | | | | | |  ..   .|.|||.|. |.|.| 
Sbjct: 110 IGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYF 169

Query: 279 FASLKGSLPWANC 291
             | .  |||  |
Sbjct: 170 SQSFQQPLPWDQC 182

>hg18||uc001szy
        |12|NM_018057|Q9H9F5|Q9H9F5_HUMAN|SLC6A15|NM_018057|NP_060527|solute
        carrier family 6, member 15 isoform 2

          Length = 289

 Score =  144 bits (361), Expect = 3e-034
 Identities = 63/133 (47%), Positives = 91/133 (68%), Gaps = 1/133 (0%)

Query: 160 DDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGI 219
           | .|| .    |  |..|. .||. ||..||||||||||||  .|||||.|.||| .| .
Sbjct:  50 DVEEGSEVEDERPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMV 109

Query: 220 AGIPIFLLEVSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYL 278
            |||.| ||.|.||   .| . ||  | | | | | |  ..   .|.|||.|. |.|.| 
Sbjct: 110 IGIPLFFLELSVGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWSLFYF 169

Query: 279 FASLKGSLPWANC 291
             | .  |||  |
Sbjct: 170 SQSFQQPLPWDQC 182

>hg18||uc002eif |16|M65105|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  142 bits (356), Expect = 1e-033
 Identities = 71/128 (55%), Positives = 89/128 (69%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||. ||| || || .||. ||||||| .||  ..   . .| .| || |||||
Sbjct: 255 GVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQ 314

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           ||||| | .| ||  .||||| |||||| .. .  |  ||  .|| |||..|.|||| ||
Sbjct: 315 IFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKV 374

Query: 429 PIEKVADE 436
            || || |
Sbjct: 375 NIEDVATE 382

>hg18||uc002eig
        |16|BC060831|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  142 bits (356), Expect = 1e-033
 Identities = 71/128 (55%), Positives = 89/128 (69%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||. ||| || || .||. ||||||| .||  ..   . .| .| || |||||
Sbjct: 255 GVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQ 314

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           ||||| | .| ||  .||||| |||||| .. .  |  ||  .|| |||..|.|||| ||
Sbjct: 315 IFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKV 374

Query: 429 PIEKVADE 436
            || || |
Sbjct: 375 NIEDVATE 382

>hg18||uc002eih
        |16|NM_001043|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 617

 Score =  142 bits (356), Expect = 1e-033
 Identities = 71/128 (55%), Positives = 89/128 (69%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||. ||| || || .||. ||||||| .||  ..   . .| .| || |||||
Sbjct: 255 GVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQ 314

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           ||||| | .| ||  .||||| |||||| .. .  |  ||  .|| |||..|.|||| ||
Sbjct: 315 IFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKV 374

Query: 429 PIEKVADE 436
            || || |
Sbjct: 375 NIEDVATE 382

>hg18||uc002eii
        |16|BC039309|P23975|SC6A2_HUMAN|SLC6A2|NM_001043|NP_001034|solute
        carrier family 6 member 2

          Length = 512

 Score =  142 bits (356), Expect = 1e-033
 Identities = 71/128 (55%), Positives = 89/128 (69%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||. ||| || || .||. ||||||| .||  ..   . .| .| || |||||
Sbjct: 150 GVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQ 209

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           ||||| | .| ||  .||||| |||||| .. .  |  ||  .|| |||..|.|||| ||
Sbjct: 210 IFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSINCITSFVSGFAIFSILGYMAHEHKV 269

Query: 429 PIEKVADE 436
            || || |
Sbjct: 270 NIEDVATE 277

>hg18||uc002hey
        |17|NM_001045|P31645|SC6A4_HUMAN|SLC6A4|NM_001045|NP_001036|solute
        carrier family 6 member 4

          Length = 630

 Score =  141 bits (354), Expect = 2e-033
 Identities = 63/128 (49%), Positives = 90/128 (70%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     ||. ||||||..| .||.|| |||||. |.|... | |.|| .  || ||| |
Sbjct: 273 GVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQ 332

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||||   .| |.  .|||||.||||.| .. .  |  ||  .|||||.|.|.||     
Sbjct: 333 IFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNE 392

Query: 429 PIEKVADE 436
            . .|| .
Sbjct: 393 DVSEVAKD 400

>hg18||uc003jby
        |5|NM_182632|Q96N87|S6A18_HUMAN|SLC6A18|NM_182632|NP_872438|solute
        carrier family 6, member 18

          Length = 628

 Score =  141 bits (354), Expect = 2e-033
 Identities = 67/141 (47%), Positives = 89/141 (63%), Gaps = 1/141 (0%)

Query: 157 ASDDDDEGGDENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTM 216
           | . |    |    |  | ||  ..|| .|.||||||.||||||    |||||||||.  
Sbjct:   4 APEPDPAACDLGDERPKWDNKAQYLLSCIGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIA 63

Query: 217 LGIAGIPIFLLEVSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTL 275
           |   ||||| .|...||   .| | ||  | | | | |.  . .| ||..||| |. | |
Sbjct:  64 LVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVL 123

Query: 276 YYLFASLKGSLPWANCRNDWN 296
           .||  | .  |||..|  | |
Sbjct: 124 WYLLNSFQHPLPWSSCPPDLN 144

>hg18||uc003jck
        |5|NM_001044|Q01959|SC6A3_HUMAN|SLC6A3|NM_001044|NP_001035|solute
        carrier family 6 (neurotransmitter

          Length = 620

 Score =  140 bits (352), Expect = 4e-033
 Identities = 74/148 (50%), Positives = 94/148 (63%), Gaps = 6/148 (4%)

Query: 295 WNTVECKDKDMLLL------GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYF 348
           |    |    ..||      ||     ||. ||| |||||  ||.|||||||| |||  .
Sbjct: 238 WQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAY 297

Query: 349 ITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATS 408
           ..  . .| .| || |||||. |||   .| ||  |||||| |||||| .. |  || ||
Sbjct: 298 LSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTS 357

Query: 409 IFAGFVIFSVIGFMAHELKVPIEKVADE 436
             .|||.|| .|.|| .  |||  || .
Sbjct: 358 FSSGFVVFSFLGYMAQKHSVPIGDVAKD 385

>hg18||uc003jbw
        |5|NM_001003841|Q695T7|S6A19_HUMAN|SLC6A19|NM_001003841|NP_001003841|so
        lute carrier family 6, member 19

          Length = 634

 Score =  139 bits (348), Expect = 1e-032
 Identities = 65/151 (43%), Positives = 97/151 (64%), Gaps = 2/151 (1%)

Query: 166 DENKARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIF 225
           .|  .|  | ||  ..|. .|. ||||||||||||   .|||||.||.| .| . |||. 
Sbjct:  27 EEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVLEGIPLL 86

Query: 226 LLEVSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKG 284
            || ..||   .| . ||  | |||.| |.| .. | .. .||| |. | ..||| | . 
Sbjct:  87 YLEFAIGQRLRRGSLGVWSSIHPALKGLGLASMLTSFMVGLYYNTIISWIMWYLFNSFQE 146

Query: 285 SLPWANCRNDWNTVECKDKDMLLLGVSDYAW 315
            |||..|  . |     |.      | || |
Sbjct: 147 PLPWSDCPLNENQTGYVDECARSSPV-DYFW 176

>hg18||uc001dzd
        |1|NM_001010898|Q9H1V8|S6A17_HUMAN|SLC6A17|NM_001010898|NP_001010898|so
        lute carrier family 6, member 17

          Length = 727

 Score =  138 bits (347), Expect = 1e-032
 Identities = 57/122 (46%), Positives = 88/122 (72%), Gaps = 1/122 (0%)

Query: 171 RGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVS 230
           |  |..|. .||. .|..|||||.||||||  .|||||.|.||| .| | |||.| ||..
Sbjct:  60 RPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELA 119

Query: 231 LGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWA 289
           .||   .| . ||  | | | | | .  |. . . .|||.|. |...| | | .  |||.
Sbjct: 120 VGQRIRRGSIGVWHYICPRLGGIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWS 179

Query: 290 NC 291
            |
Sbjct: 180 EC 181

>hg18||uc003cou
        |3|NM_020208|Q9NP91|S6A20_HUMAN|SLC6A20|NM_020208|NP_064593|solute
        carrier family 6, member 20 isoform 1

          Length = 592

 Score =  138 bits (346), Expect = 2e-032
 Identities = 58/124 (46%), Positives = 85/124 (68%), Gaps = 1/124 (0%)

Query: 169 KARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLE 228
           |||  |.| . |. . . ||||||||||||||    |||.||.||. || . |.|.  ||
Sbjct:   3 KARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLE 62

Query: 229 VSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLP 287
           ...||   || .  |. | | | | |.| ...|  ...|||.|  |  .||| | .  ||
Sbjct:  63 LAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLP 122

Query: 288 WANC 291
           |. |
Sbjct: 123 WSVC 126

>hg18||uc003cov
        |3|NM_022405|Q9NP91-2|Q9NP91-2|SLC6A20|NM_022405|NP_071800|solute
        carrier family 6, member 20 isoform 2

          Length = 555

 Score =  138 bits (346), Expect = 2e-032
 Identities = 58/124 (46%), Positives = 85/124 (68%), Gaps = 1/124 (0%)

Query: 169 KARGNWSNKMDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLE 228
           |||  |.| . |. . . ||||||||||||||    |||.||.||. || . |.|.  ||
Sbjct:   3 KARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLE 62

Query: 229 VSLGQFASQGPVSVWKCI-PALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLP 287
           ...||   || .  |. | | | | |.| ...|  ...|||.|  |  .||| | .  ||
Sbjct:  63 LAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLP 122

Query: 288 WANC 291
           |. |
Sbjct: 123 WSVC 126

>hg18||uc003byq
        |3|NM_003043|P31641|SC6A6_HUMAN|SLC6A6|NM_003043|NP_003034|solute
        carrier family 6 (neurotransmitter

          Length = 620

 Score =  135 bits (339), Expect = 1e-031
 Identities = 65/127 (51%), Positives = 87/127 (68%)

Query: 309 GVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDAATQ 368
           ||     |||||||||. .|..||.||.|||||  || ... |   .| | .|| || ||
Sbjct: 238 GVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQ 297

Query: 369 IFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKV 428
           |||| .   | . .| ||||.  | ||| ... | || ||  .|| |||..|||| |  |
Sbjct: 298 IFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGV 357

Query: 429 PIEKVAD 435
            |  ||.
Sbjct: 358 DIADVAE 364

>hg18||uc003jby
        |5|NM_182632|Q96N87|S6A18_HUMAN|SLC6A18|NM_182632|NP_872438|solute
        carrier family 6, member 18

          Length = 628

 Score =  129 bits (322), Expect = 1e-029
 Identities = 60/118 (50%), Positives = 80/118 (67%)

Query: 306 LLLGVSDYAWVVYFTATFPYVVLIILLIRGVTLPGAFDGILYFITPKWEKLNDAKVWKDA 365
           .. |.     |.|||| |||.|| | ||||.|||||  |..|  ||    | . .|| ||
Sbjct: 198 VIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDA 257

Query: 366 ATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMA 423
           ||||||||| |.|| |  .|||   |.| .| |..   |  ||..|   .|||.|| |
Sbjct: 258 ATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKA 315

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 192,139,604
Number of Sequences: 45480
Number of Extensions: 192139604
Number of Successful Extensions: 10945510
Number of sequences better than 0.0: 0
BLASTP 7.6.0