BLASTP 7.6.0


Query=fugu4_747428 |jgi|Takru4|747428|fgh5_pg.C_scaffold_5946000002
        (125 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002asq |15|NM_001008224|Q14DD3|Q14DD3_HUMAN|UACA|NM_0010...     29   0.894
hg18||uc002asr |15|NM_018003|Q9BZF9|UACA_HUMAN|UACA|NM_018003|NP...     29   0.894
hg18||uc001awd |1|AB067524|Q5JYW7|Q5JYW7_HUMAN|RP3-467K16.1|NA|N...     28   1.525
hg18||uc001awe |1|AX748350|Q8N9T6|Q8N9T6_HUMAN|KIAA1937|NA|NA|CD...     28   1.525
hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP...     28   1.991
hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KI...     28   1.991
hg18||uc001ncb |11|AB051483|Q96BD5-2|Q96BD5-2|PHF21A|NM_016621|N...     27   2.601
hg18||uc001ncc |11|BC015714|Q96BD5|PF21A_HUMAN|PHF21A|NM_016621|...     27   2.601
hg18||uc001ncd |11|NM_016621|Q96BD5-2|Q96BD5-2|PHF21A|NM_016621|...     27   2.601
hg18||uc001nce |11|AK021530|NA|NA|KIAA1696|NA|NA|Homo sapiens mR...     27   2.601
hg18||uc001kgr |10|NM_016195|Q96Q89-3|Q96Q89-3|MPHOSPH1|NM_01619...     27   4.436
hg18||uc001kgs |10|AB033337|Q96Q89|MPPH1_HUMAN|MPHOSPH1|NM_01619...     27   4.436
hg18||uc001kgt |10|AL137392|NA|NA|MPHOSPH1|NM_016195|NP_057279|M...     27   4.436
hg18||uc002ilj |17|NM_000212|A0PJW2|A0PJW2_HUMAN|ITGB3|NM_000212...     27   4.436
hg18||uc002muy |19|NM_013312|Q96ED9|HOOK2_HUMAN|HOOK2|NM_013312|...     27   4.436
hg18||uc002muz |19|DQ896679|Q96ED9-2|Q96ED9-2|HOOK2|NM_013312|NP...     27   4.436
hg18||uc004bkx |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018...     26   5.794
hg18||uc004blb |9|AF083322|Q9Y489|Q9Y489_HUMAN|CEP110|NM_007018|...     26   5.794
hg18||uc002fda |16|NM_018124|Q6PCD5|Q6PCD5_HUMAN|RFWD3|NM_018124...     26   7.567
hg18||uc003dhu |3|NM_001012506|Q4VC34|Q4VC34_HUMAN|CCDC66|NM_001...     26   7.567
hg18||uc003dhy |3|AL832692|NA|NA|CCDC66|NA|NA|Homo sapiens cDNA ...     26   7.567
hg18||uc003dhz |3|BC132827|NA|NA|CCDC66|NA|NA|Homo sapiens cDNA ...     26   7.567
hg18||uc003mka |5|NM_025158|Q96T51|RUFY1_HUMAN|RUFY1|NM_025158|N...     26   7.567
hg18||uc003mkb |5|NM_001040452|Q96T51-2|Q96T51-2|RUFY1|NM_001040...     26   7.567
hg18||uc003mkc |5|NM_001040451|Q96T51-2|Q96T51-2|RUFY1|NM_001040...     26   7.567
hg18||uc003mkd |5|AK093848|NA|NA|RUFY1|NM_001040452|NP_001035542...     26   7.567
hg18||uc003ulf |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP...     26   7.567
hg18||uc003ulg |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP...     26   7.567
hg18||uc003ulh |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|N...     26   7.567
hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_...     26   7.567
hg18||uc003ulj |7|AF091711|NA|NA|AKAP9|NM_147185|NP_671714|A-kin...     26   7.567
hg18||uc003ull |7|AK026444|NA|NA|KIAA0803|NA|NA|Homo sapiens mRN...     26   7.567
hg18||uc003zqf |9|BC107742|Q3B789|Q3B789_HUMAN|IFT74|NA|NA|IFT74...     26   7.567
hg18||uc001czo |1|NM_015888|Q9UJC3|HOOK1_HUMAN|HOOK1|NM_015888|N...     25   9.883
hg18||uc001kxw |10|NM_025145|NA|NA|C10orf79|NM_025145|NP_079421|...     25   9.883
hg18||uc002pnm |19|NM_144688|Q96MC3|Q96MC3_HUMAN|FLJ32658|NM_144...     25   9.883
hg18||uc002rfe |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|N...     25   9.883
hg18||uc002rff |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP...     25   9.883
hg18||uc002rfg |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP...     25   9.883
hg18||uc002uuy |2|AK056638|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|NP...     25   9.883
hg18||uc002uuz |2|NM_015265|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|N...     25   9.883
hg18||uc002uva |2|AB209376|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|NP...     25   9.883

>hg18||uc002asq
        |15|NM_001008224|Q14DD3|Q14DD3_HUMAN|UACA|NM_001008224|NP_001008225|uve
        al autoantigen with coiled-coil domains and

          Length = 1403

 Score =  29 bits (63), Expect = 0.894
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query:  29 FEKPRSPENDLVPKER--ADWKKQLHELQEKCGKMERQLFYTEQHNRYLK 76
           |  |   | ...  .    . |||| ||..|||. . ..      |  ||
Sbjct: 790 FVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEKIHALTSENTNLK 839

>hg18||uc002asr |15|NM_018003|Q9BZF9|UACA_HUMAN|UACA|NM_018003|NP_060473|uveal
        autoantigen with coiled-coil domains and

          Length = 1416

 Score =  29 bits (63), Expect = 0.894
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query:  29 FEKPRSPENDLVPKER--ADWKKQLHELQEKCGKMERQLFYTEQHNRYLK 76
           |  |   | ...  .    . |||| ||..|||. . ..      |  ||
Sbjct: 803 FVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEKIHALTSENTNLK 852

>hg18||uc001awd |1|AB067524|Q5JYW7|Q5JYW7_HUMAN|RP3-467K16.1|NA|NA|Novel protein
        (Fragment)

          Length = 627

 Score =  28 bits (61), Expect = 1.525
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query:  45 ADWKKQLHELQEKCGKMERQLFYTEQHNR---YLKDNLQQVKELMEKKDEEI 93
           .| . .|.| |.   ..|. .   .| ..    ||. . |.  |.|||| |.
Sbjct: 279 SDLRGELNEKQKM--ELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL 328

>hg18||uc001awe |1|AX748350|Q8N9T6|Q8N9T6_HUMAN|KIAA1937|NA|NA|CDNA FLJ36564
        fis, clone TRACH2009851

          Length = 600

 Score =  28 bits (61), Expect = 1.525
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query:  45 ADWKKQLHELQEKCGKMERQLFYTEQHNR---YLKDNLQQVKELMEKKDEEI 93
           .| . .|.| |.   ..|. .   .| ..    ||. . |.  |.|||| |.
Sbjct: 214 SDLRGELNEKQKM--ELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL 263

>hg18||uc004bgr |9|BC077732|Q6DD85|Q6DD85_HUMAN|FKBP15|NA|NA|FKBP15 protein
        (Fragment)

          Length = 656

 Score =  28 bits (60), Expect = 1.991
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query:  43 ERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDE 91
           .|  ....| .|||||  .. |.          | | | .||| . | .
Sbjct: 267 QRDAYQQKLVQLQEKCLALQAQI------TALTKQNEQHIKELEKNKSQ 309

>hg18||uc004bgs |9|AB014574|Q9Y4D0|Q9Y4D0_HUMAN|KIAA0674|NA|NA|KIAA0674 protein
        (Fragment)

          Length = 1219

 Score =  28 bits (60), Expect = 1.991
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query:  43 ERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDE 91
           .|  ....| .|||||  .. |.          | | | .||| . | .
Sbjct: 830 QRDAYQQKLVQLQEKCLALQAQI------TALTKQNEQHIKELEKNKSQ 872

>hg18||uc001ncb
        |11|AB051483|Q96BD5-2|Q96BD5-2|PHF21A|NM_016621|NP_057705|BRAF35/HDAC2
        complex

          Length = 634

 Score =  27 bits (59), Expect = 2.601
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 43 ERADWKKQLHELQEKCGKM-ERQLFYTEQHNRYLKDNLQQVKELMEK 88
          . || |||||||| |   . |.|    ||    |. ||   .|  .|
Sbjct: 29 QNADLKKQLHELQAKITALSEKQKRVVEQ----LRKNLIVKQEQPDK 71

>hg18||uc001ncc
        |11|BC015714|Q96BD5|PF21A_HUMAN|PHF21A|NM_016621|NP_057705|BRAF35/HDAC2
        complex

          Length = 680

 Score =  27 bits (59), Expect = 2.601
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 43 ERADWKKQLHELQEKCGKM-ERQLFYTEQHNRYLKDNLQQVKELMEK 88
          . || |||||||| |   . |.|    ||    |. ||   .|  .|
Sbjct: 29 QNADLKKQLHELQAKITALSEKQKRVVEQ----LRKNLIVKQEQPDK 71

>hg18||uc001ncd
        |11|NM_016621|Q96BD5-2|Q96BD5-2|PHF21A|NM_016621|NP_057705|BRAF35/HDAC2
        complex

          Length = 634

 Score =  27 bits (59), Expect = 2.601
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 43 ERADWKKQLHELQEKCGKM-ERQLFYTEQHNRYLKDNLQQVKELMEK 88
          . || |||||||| |   . |.|    ||    |. ||   .|  .|
Sbjct: 29 QNADLKKQLHELQAKITALSEKQKRVVEQ----LRKNLIVKQEQPDK 71

>hg18||uc001nce |11|AK021530|NA|NA|KIAA1696|NA|NA|Homo sapiens mRNA for KIAA1696
        protein, partial cds

          Length = 484

 Score =  27 bits (59), Expect = 2.601
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 43 ERADWKKQLHELQEKCGKM-ERQLFYTEQHNRYLKDNLQQVKELMEK 88
          . || |||||||| |   . |.|    ||    |. ||   .|  .|
Sbjct: 29 QNADLKKQLHELQAKITALSEKQKRVVEQ----LRKNLIVKQEQPDK 71

>hg18||uc001kgr
        |10|NM_016195|Q96Q89-3|Q96Q89-3|MPHOSPH1|NM_016195|NP_057279|M-phase
        phosphoprotein 1

          Length = 1780

 Score =  27 bits (57), Expect = 4.436
 Identities = 18/68 (26%), Positives = 34/68 (50%)

Query:   15 ETELMGRPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRY 74
            . |. |   |. |  ||    ..||. ..    ..   |||||   .. |. .  .  | 
Sbjct: 1049 QAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQHVVEGKRA 1108

Query:   75 LKDNLQQV 82
            | .  | |
Sbjct: 1109 LSELTQGV 1116

>hg18||uc001kgs
        |10|AB033337|Q96Q89|MPPH1_HUMAN|MPHOSPH1|NM_016195|NP_057279|M-phase
        phosphoprotein 1

          Length = 1820

 Score =  27 bits (57), Expect = 4.436
 Identities = 18/68 (26%), Positives = 34/68 (50%)

Query:   15 ETELMGRPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRY 74
            . |. |   |. |  ||    ..||. ..    ..   |||||   .. |. .  .  | 
Sbjct: 1089 QAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQHVVEGKRA 1148

Query:   75 LKDNLQQV 82
            | .  | |
Sbjct: 1149 LSELTQGV 1156

>hg18||uc001kgt |10|AL137392|NA|NA|MPHOSPH1|NM_016195|NP_057279|M-phase
        phosphoprotein 1

          Length = 1031

 Score =  27 bits (57), Expect = 4.436
 Identities = 18/68 (26%), Positives = 34/68 (50%)

Query:  15 ETELMGRPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRY 74
           . |. |   |. |  ||    ..||. ..    ..   |||||   .. |. .  .  | 
Sbjct: 300 QAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQHVVEGKRA 359

Query:  75 LKDNLQQV 82
           | .  | |
Sbjct: 360 LSELTQGV 367

>hg18||uc002ilj
        |17|NM_000212|A0PJW2|A0PJW2_HUMAN|ITGB3|NM_000212|NP_000203|integrin
        beta chain, beta 3 precursor

          Length = 788

 Score =  27 bits (57), Expect = 4.436
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query:  57 KCGKMERQLFYTEQH-NRYLKDNLQQVKELME 87
           .| | .|   . |   ||| .| .. |||| .
Sbjct: 642 ECKKFDRGALHDENTCNRYCRDEIESVKELKD 673

>hg18||uc002muy |19|NM_013312|Q96ED9|HOOK2_HUMAN|HOOK2|NM_013312|NP_037444|hook
        homolog 2

          Length = 719

 Score =  27 bits (57), Expect = 4.436
 Identities = 15/63 (23%), Positives = 27/63 (42%)

Query:  53 ELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDEEIAXXXXXXXXXXXXXXMGEI 112
           |||..|  .||||    .  . |      ..| | . . |                . ..
Sbjct: 189 ELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKLLLLQSQLEQL 248

Query: 113 QEE 115
           |||
Sbjct: 249 QEE 251

>hg18||uc002muz |19|DQ896679|Q96ED9-2|Q96ED9-2|HOOK2|NM_013312|NP_037444|hook
        homolog 2

          Length = 717

 Score =  27 bits (57), Expect = 4.436
 Identities = 15/63 (23%), Positives = 27/63 (42%)

Query:  53 ELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDEEIAXXXXXXXXXXXXXXMGEI 112
           |||..|  .||||    .  . |      ..| | . . |                . ..
Sbjct: 189 ELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKLLLLQSQLEQL 248

Query: 113 QEE 115
           |||
Sbjct: 249 QEE 251

>hg18||uc004bkx
        |9|NM_007018|Q7Z7A1|Q7Z7A1_HUMAN|CEP110|NM_007018|NP_008949|centrosomal
        protein 110kDa

          Length = 2325

 Score =  26 bits (56), Expect = 5.794
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 7/52 (13%)

Query:   49 KQLHELQEKCGKMERQLFYT-------EQHNRYLKDNLQQVKELMEKKDEEI 93
            |.  .|||||   |..|  |       |....  . ||....  . |  .|.
Sbjct: 1787 KEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQEL 1838

>hg18||uc004blb
        |9|AF083322|Q9Y489|Q9Y489_HUMAN|CEP110|NM_007018|NP_008949|centrosomal
        protein 110kDa

          Length = 994

 Score =  26 bits (56), Expect = 5.794
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 7/52 (13%)

Query:  49 KQLHELQEKCGKMERQLFYT-------EQHNRYLKDNLQQVKELMEKKDEEI 93
           |.  .|||||   |..|  |       |....  . ||....  . |  .|.
Sbjct: 456 KEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQEL 507

>hg18||uc002fda |16|NM_018124|Q6PCD5|Q6PCD5_HUMAN|RFWD3|NM_018124|NP_060594|ring
        finger and WD repeat domain 3

          Length = 774

 Score =  26 bits (55), Expect = 7.567
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query:  43 ERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQ 81
           | |  . ||  | .|| ...|..   ..   .   ||||
Sbjct: 375 ESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQ 413

>hg18||uc003dhu
        |3|NM_001012506|Q4VC34|Q4VC34_HUMAN|CCDC66|NM_001012506|NP_001012524|co
        iled-coil domain containing 66

          Length = 831

 Score =  26 bits (55), Expect = 7.567
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query:  21 RPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQ 80
           | |   .  |  ..    .  | |   |||| | | |  . | .|   ..     |   .
Sbjct: 340 RDRRRQKQLEHQKAITAQVEEKRR---KKQLEEEQRKKEEQEEELRLAQEREEMQKQYEE 396

Query:  81 QVKELMEKKDEEI 93
            .  | .|. |||
Sbjct: 397 DI--LKQKQKEEI 407

>hg18||uc003dhy |3|AL832692|NA|NA|CCDC66|NA|NA|Homo sapiens cDNA FLJ38369 fis,
        clone FEBRA2001828

          Length = 584

 Score =  26 bits (55), Expect = 7.567
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query:  21 RPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQ 80
           | |   .  |  ..    .  | |   |||| | | |  . | .|   ..     |   .
Sbjct:  93 RDRRRQKQLEHQKAITAQVEEKRR---KKQLEEEQRKKEEQEEELRLAQEREEMQKQYEE 149

Query:  81 QVKELMEKKDEEI 93
            .  | .|. |||
Sbjct: 150 DI--LKQKQKEEI 160

>hg18||uc003dhz |3|BC132827|NA|NA|CCDC66|NA|NA|Homo sapiens cDNA FLJ38369 fis,
        clone FEBRA2001828

          Length = 948

 Score =  26 bits (55), Expect = 7.567
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query:  21 RPREHPRDFEKPRSPENDLVPKERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQ 80
           | |   .  |  ..    .  | |   |||| | | |  . | .|   ..     |   .
Sbjct: 457 RDRRRQKQLEHQKAITAQVEEKRR---KKQLEEEQRKKEEQEEELRLAQEREEMQKQYEE 513

Query:  81 QVKELMEKKDEEI 93
            .  | .|. |||
Sbjct: 514 DI--LKQKQKEEI 524

>hg18||uc003mka |5|NM_025158|Q96T51|RUFY1_HUMAN|RUFY1|NM_025158|NP_079434|RUN
        and FYVE domain-containing 1 isoform a

          Length = 708

 Score =  26 bits (55), Expect = 7.567
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query:  48 KKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQV----KELMEKKDEE 92
           .|.|   .|.   ..|.| . .  .  |.  ||||    ||| | .||.
Sbjct: 548 EKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEK 596

>hg18||uc003mkb
        |5|NM_001040452|Q96T51-2|Q96T51-2|RUFY1|NM_001040452|NP_001035542|RUN
        and FYVE domain-containing 1 isoform b

          Length = 600

 Score =  26 bits (55), Expect = 7.567
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query:  48 KKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQV----KELMEKKDEE 92
           .|.|   .|.   ..|.| . .  .  |.  ||||    ||| | .||.
Sbjct: 440 EKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEK 488

>hg18||uc003mkc
        |5|NM_001040451|Q96T51-2|Q96T51-2|RUFY1|NM_001040451|NP_001035541|RUN
        and FYVE domain-containing 1 isoform b

          Length = 600

 Score =  26 bits (55), Expect = 7.567
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query:  48 KKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQV----KELMEKKDEE 92
           .|.|   .|.   ..|.| . .  .  |.  ||||    ||| | .||.
Sbjct: 440 EKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEK 488

>hg18||uc003mkd |5|AK093848|NA|NA|RUFY1|NM_001040452|NP_001035542|RUN and FYVE
        domain-containing 1 isoform b

          Length = 310

 Score =  26 bits (55), Expect = 7.567
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query:  48 KKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQV----KELMEKKDEE 92
           .|.|   .|.   ..|.| . .  .  |.  ||||    ||| | .||.
Sbjct: 150 EKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEK 198

>hg18||uc003ulf
        |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP_671714|A-kinase
        anchor protein 9 isoform 3

          Length = 3899

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:   27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
            .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 3370 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 3429

Query:   84 ELMEK 88
             .|..
Sbjct: 3430 GIMQE 3434

>hg18||uc003ulg
        |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3907

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:   27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
            .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 3378 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 3437

Query:   84 ELMEK 88
             .|..
Sbjct: 3438 GIMQE 3442

>hg18||uc003ulh
        |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|NP_671700|A-kinase
        anchor protein 9 isoform 1

          Length = 3911

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:   27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
            .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 3382 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 3441

Query:   84 ELMEK 88
             .|..
Sbjct: 3442 GIMQE 3446

>hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3530

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:   27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
            .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 3001 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 3060

Query:   84 ELMEK 88
             .|..
Sbjct: 3061 GIMQE 3065

>hg18||uc003ulj |7|AF091711|NA|NA|AKAP9|NM_147185|NP_671714|A-kinase anchor
        protein 9 isoform 3

          Length = 1693

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:   27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
            .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 1148 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 1207

Query:   84 ELMEK 88
             .|..
Sbjct: 1208 GIMQE 1212

>hg18||uc003ull |7|AK026444|NA|NA|KIAA0803|NA|NA|Homo sapiens mRNA for KIAA0803
        protein, partial cds

          Length = 803

 Score =  26 bits (55), Expect = 7.567
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query:  27 RDFEKPRSPENDLVPKER---ADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVK 83
           .  || |      .  |.    . .|..|||| |   ..|||    |    |    |...
Sbjct: 274 QQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDLEGQRLQ 333

Query:  84 ELMEK 88
            .|..
Sbjct: 334 GIMQE 338

>hg18||uc003zqf |9|BC107742|Q3B789|Q3B789_HUMAN|IFT74|NA|NA|IFT74 protein

          Length = 372

 Score =  26 bits (55), Expect = 7.567
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query:  42 KERADWKKQLHELQEKCGKMERQLFYT-EQHNRYLKDNLQQVKELMEKKD 90
           .||    ||. .  ..   |||||  | |. |.....  |   .| | .|
Sbjct: 303 EEREKLLKQIKDDNQEIASMERQLTDTKEKINQFIEEIRQLDMDLEEHQD 352

>hg18||uc001czo |1|NM_015888|Q9UJC3|HOOK1_HUMAN|HOOK1|NM_015888|NP_056972|hook
        homolog 1

          Length = 728

 Score =  25 bits (54), Expect = 9.883
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 14/70 (20%)

Query:  34 SPENDLVPKERADWKKQLHELQE----------KCGKMERQLFYTEQHNRYLKDNLQQVK 83
           || || | .     |. | ||||          .| ... |.   .      |..|    
Sbjct: 167 SPPNDAVGELEQQLKRALEELQEALAEKEELRQRCEELDMQVTTLQDE----KNSLVSEN 222

Query:  84 ELMEKKDEEI 93
           |.| .| ...
Sbjct: 223 EMMNEKLDQL 232

>hg18||uc001kxw |10|NM_025145|NA|NA|C10orf79|NM_025145|NP_079421|hypothetical
        protein LOC80217

          Length = 1665

 Score =  25 bits (54), Expect = 9.883
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query:   67 YTEQHNRYLKDNLQQVKELMEKKDE 91
            .||.  .  ||  ..|||| |..|.
Sbjct: 1153 WTEEERKQFKDYEKKVKELNEERDK 1177

>hg18||uc002pnm
        |19|NM_144688|Q96MC3|Q96MC3_HUMAN|FLJ32658|NM_144688|NP_653289|hypothet
        ical protein LOC147872

          Length = 562

 Score =  25 bits (54), Expect = 9.883
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query:  36 ENDLVPKERADWKKQLHELQEKCGKMERQLFYTE----QHNRYLKDNLQQVKELMEKKDE 91
           ||  .  ||   ||.  ||  .   ..||||  |    | .  | .  . |. | .  .|
Sbjct: 266 ENGKLLAERDGVKKRSQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEE 325

>hg18||uc002rfe
        |2|NM_006277|Q9NZM3|ITSN2_HUMAN|ITSN2|NM_006277|NP_006268|intersectin 2
        isoform 1

          Length = 1696

 Score =  25 bits (54), Expect = 9.883
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query:  42 KERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDEE 92
           ||. .|...  ||||.  | . .|    .  |     |.. .|   .|| |
Sbjct: 398 KEKEEWERKQRELQEQEWKKQLELEKRLEKQR----ELERQREEERRKDIE 444

>hg18||uc002rff
        |2|NM_019595|Q9NZM3-2|Q9NZM3-2|ITSN2|NM_019595|NP_062541|intersectin 2
        isoform 3

          Length = 1669

 Score =  25 bits (54), Expect = 9.883
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query:  42 KERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDEE 92
           ||. .|...  ||||.  | . .|    .  |     |.. .|   .|| |
Sbjct: 398 KEKEEWERKQRELQEQEWKKQLELEKRLEKQR----ELERQREEERRKDIE 444

>hg18||uc002rfg
        |2|NM_147152|Q9NZM3-3|Q9NZM3-3|ITSN2|NM_147152|NP_671494|intersectin 2
        isoform 2

          Length = 1248

 Score =  25 bits (54), Expect = 9.883
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query:  42 KERADWKKQLHELQEKCGKMERQLFYTEQHNRYLKDNLQQVKELMEKKDEE 92
           ||. .|...  ||||.  | . .|    .  |     |.. .|   .|| |
Sbjct: 398 KEKEEWERKQRELQEQEWKKQLELEKRLEKQR----ELERQREEERRKDIE 444

>hg18||uc002uuy |2|AK056638|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|NP_056080|SATB
        family member 2

          Length = 733

 Score =  25 bits (54), Expect = 9.883
 Identities = 13/55 (23%), Positives = 24/55 (43%)

Query:  67 YTEQHNRYLKDNLQQVKELMEKKDEEIAXXXXXXXXXXXXXXMGEIQEELNGVDE 121
           |  .|.  ||..|    .. | ||||.               | ... |    |.
Sbjct: 668 YHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADK 722

>hg18||uc002uuz |2|NM_015265|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|NP_056080|SATB
        family member 2

          Length = 733

 Score =  25 bits (54), Expect = 9.883
 Identities = 13/55 (23%), Positives = 24/55 (43%)

Query:  67 YTEQHNRYLKDNLQQVKELMEKKDEEIAXXXXXXXXXXXXXXMGEIQEELNGVDE 121
           |  .|.  ||..|    .. | ||||.               | ... |    |.
Sbjct: 668 YHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADK 722

>hg18||uc002uva |2|AB209376|Q9UPW6|SATB2_HUMAN|SATB2|NM_015265|NP_056080|SATB
        family member 2

          Length = 733

 Score =  25 bits (54), Expect = 9.883
 Identities = 13/55 (23%), Positives = 24/55 (43%)

Query:  67 YTEQHNRYLKDNLQQVKELMEKKDEEIAXXXXXXXXXXXXXXMGEIQEELNGVDE 121
           |  .|.  ||..|    .. | ||||.               | ... |    |.
Sbjct: 668 YHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADK 722

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0