BLASTP 7.6.0


Query=fugu4_747419 |jgi|Takru4|747419|fgh5_pg.C_scaffold_5909000001
        (127 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-i...     43   7e-005
hg18||uc001ghs |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172...     43   7e-005
hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-i...     41   3e-004
hg18||uc001ghs |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172...     41   3e-004
hg18||uc001xno |14|NM_021239|P49756|RBM25_HUMAN|RBM25|NM_021239|...     39   0.001
hg18||uc001xnp |14|AK094697|NA|NA|RBM25|NA|NA|Homo sapiens cDNA:...     39   0.001
hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|N...     33   0.095
hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|N...     31   0.277
hg18||uc002cte |16|AL833749|Q658L9|Q658L9_HUMAN|DKFZp666L166|NA|...     31   0.362
hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|...     31   0.362
hg18||uc002cte |16|AL833749|Q658L9|Q658L9_HUMAN|DKFZp666L166|NA|...     30   0.472
hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|...     30   0.472
hg18||uc002xpf |20|NM_080614|Q8IUB2|WFDC3_HUMAN|WFDC3|NM_080614|...     30   0.617
hg18||uc003tkb |7|NM_001129|Q8IUX7|Q8IUX7_HUMAN|AEBP1|NM_001129|...     30   0.806
hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|N...     29   1.052
hg18||uc002uyy |2|BC118982|Q0VF49|Q0VF49_HUMAN|LOC339809|NA|NA|K...     29   1.052
hg18||uc001hdc |1|NM_022731|Q9H1E3|NUCKS_HUMAN|NUCKS1|NM_022731|...     28   3.061
hg18||uc004flk |X|NM_004699|Q14320|FA50A_HUMAN|FAM50A|NM_004699|...     27   3.998
hg18||uc004fll |X|BC000028|Q14320|FA50A_HUMAN|FAM50A|NM_004699|N...     27   3.998
hg18||uc001gbx |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_1825...     27   5.221
hg18||uc002uyy |2|BC118982|Q0VF49|Q0VF49_HUMAN|LOC339809|NA|NA|K...     27   5.221
hg18||uc001ccz |1|NM_012090|NA|NA|MACF1|NM_012090|NP_036222|micr...     27   6.819
hg18||uc001cda |1|AF141968|NA|NA|MACF1|NM_012090|NP_036222|micro...     27   6.819
hg18||uc001cdb |1|AB033077|NA|NA|KIAA0465|NA|NA|Homo sapiens mRN...     27   6.819
hg18||uc001cdc |1|AB007934|NA|NA|MACF1|NM_012090|NP_036222|micro...     27   6.819
hg18||uc001cdd |1|NM_033044|NA|NA|MACF1|NM_033044|NP_149033|micr...     27   6.819
hg18||uc001hdc |1|NM_022731|Q9H1E3|NUCKS_HUMAN|NUCKS1|NM_022731|...     27   6.819
hg18||uc002fmx |16|NM_013275|Q6UB99|ANR11_HUMAN|ANKRD11|NM_01327...     27   6.819
hg18||uc002fmy |16|AY533563|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275...     27   6.819
hg18||uc002fnb |16|AK025964|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275...     27   6.819
hg18||uc002fnc |16|BC069013|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275...     27   6.819
hg18||uc003sps |7|NM_032172|NA|NA|USP42|NM_032172|NP_115548|ubiq...     27   6.819
hg18||uc001ehk |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996...     26   8.906
hg18||uc001gbx |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_1825...     26   8.906
hg18||uc001gbx |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_1825...     26   8.906
hg18||uc001gbx |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_1825...     26   8.906

>hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-iso (Fragment)

          Length = 624

 Score =  43 bits (100), Expect = 7e-005
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query:  24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
           |..||    .|. ||.   .|. .|     || ||    .||  |.    || ||     
Sbjct: 504 EEIREREREKEREREKELEKEQEQEREKEREKDRERQQEKEKELEK--EQEKQREMEKER 561

Query:  84 EKLREETCPREKLREETCPREKLREETCPREKLREE 119
           .. .|.   |.| .|.   . | .|. |  || ||.
Sbjct: 562 KQEKEKELERQKEKEKELQKMKEQEKECELEKEREK 597

>hg18||uc001ghs
        |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172|NP_055987|HBxAg
        transactivated protein 2

          Length = 2817

 Score =  43 bits (100), Expect = 7e-005
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query:  24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
           |..||    .|. ||.   .|. .|     || ||    .||  |.    || ||     
Sbjct: 502 EEIREREREKEREREKELEKEQEQEREKEREKDRERQQEKEKELEK--EQEKQREMEKER 559

Query:  84 EKLREETCPREKLREETCPREKLREETCPREKLREE 119
           .. .|.   |.| .|.   . | .|. |  || ||.
Sbjct: 560 KQEKEKELERQKEKEKELQKMKEQEKECELEKEREK 595

>hg18||uc001ghr |1|BC058930|Q9H2N2|Q9H2N2_HUMAN|XTP2|NA|NA|BAT2-iso (Fragment)

          Length = 624

 Score =  41 bits (95), Expect = 3e-004
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query:  23 REKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCP 82
           ||| ||     || .|.   .|. ..     || .|    .|| ||     .. .|.   
Sbjct: 511 REKEREREKELEKEQEQEREKEREKDRERQQEKEKELEKEQEKQREMEKERKQEKEKELE 570

Query:  83 PEKLREETCPREKLREETC----PREKLREETCPRE 114
            .| .|.   . | .|. |     |||| |.  |||
Sbjct: 571 RQKEKEKELQKMKEQEKECELEKEREKLEEKIEPRE 606

>hg18||uc001ghs
        |1|NM_015172|Q9Y520|Q9Y520_HUMAN|BAT2D1|NM_015172|NP_055987|HBxAg
        transactivated protein 2

          Length = 2817

 Score =  41 bits (95), Expect = 3e-004
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query:  23 REKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCP 82
           ||| ||     || .|.   .|. ..     || .|    .|| ||     .. .|.   
Sbjct: 509 REKEREREKELEKEQEQEREKEREKDRERQQEKEKELEKEQEKQREMEKERKQEKEKELE 568

Query:  83 PEKLREETCPREKLREETC----PREKLREETCPRE 114
            .| .|.   . | .|. |     |||| |.  |||
Sbjct: 569 RQKEKEKELQKMKEQEKECELEKEREKLEEKIEPRE 604

>hg18||uc001xno |14|NM_021239|P49756|RBM25_HUMAN|RBM25|NM_021239|NP_067062|RNA
        binding motif protein 25

          Length = 843

 Score =  39 bits (90), Expect = 0.001
 Identities = 28/103 (27%), Positives = 49/103 (47%)

Query:  23 REKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCP 82
           |.. .|    |.. |.    ||.  .      . ||..  ||. ||     |. ||    
Sbjct: 351 RDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERE 410

Query:  83 PEKLREETCPREKLREETCPREKLREETCPREKLREETCPPEK 125
            |. ||    ||. ||.   |..  .|    |. . |    ||
Sbjct: 411 REREREREREREREREKDKKRDREEDEEDAYERRKLERKLREK 453

>hg18||uc001xnp |14|AK094697|NA|NA|RBM25|NA|NA|Homo sapiens cDNA: FLJ22454 fis,
        clone HRC09703

          Length = 638

 Score =  39 bits (90), Expect = 0.001
 Identities = 28/103 (27%), Positives = 49/103 (47%)

Query:  23 REKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCP 82
           |.. .|    |.. |.    ||.  .      . ||..  ||. ||     |. ||    
Sbjct: 146 RDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERE 205

Query:  83 PEKLREETCPREKLREETCPREKLREETCPREKLREETCPPEK 125
            |. ||    ||. ||.   |..  .|    |. . |    ||
Sbjct: 206 REREREREREREREREKDKKRDREEDEEDAYERRKLERKLREK 248

>hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|NA|Novel protein
        (Fragment)

          Length = 473

 Score =  33 bits (73), Expect = 0.095
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 10/108 (9%)

Query:  22 VREKLREETCPREKLREETCHR-EKLREETCPPEKLREETCPREK--LREETCPPEKLRE 78
           ..|||||    .||| ||   . |||. .     .| ||    |.   .|     | | |
Sbjct: 364 LQEKLREHLAEKEKLNEERLEQEEKLKAKI---RQLTEEKAALEEYITQERNRAKETLEE 420

Query:  79 ETCPPEKLREETCPREKLREETCPREKLREETCPREKLREETCPPEKL 126
           |    ..|      ..|   ..  .|| |     .| | ||    ..|
Sbjct: 421 ERKRMQELESLLAQQKKALAKSITQEKNR----VKEALEEEQTRVQEL 464

>hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|NA|Novel protein
        (Fragment)

          Length = 473

 Score =  31 bits (69), Expect = 0.277
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query:  28 EETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPPEKLR 87
           ...  .|||||    .||| |     |.| .|   . |.|. |     | |         
Sbjct: 360 QQSLLQEKLREHLAEKEKLNE-----ERLEQEEKLKAKIRQLTEEKAALEEYITQERNRA 414

Query:  88 EETCPREKLR 97
           .||   |. |
Sbjct: 415 KETLEEERKR 424

>hg18||uc002cte |16|AL833749|Q658L9|Q658L9_HUMAN|DKFZp666L166|NA|NA|Hypothetical
        protein DKFZp666L166

          Length = 301

 Score =  31 bits (68), Expect = 0.362
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%)

Query:  25 KLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREE----TCPPEKLREET 80
           | |. . |.    ||     | |    | | | |.     ||..|        . |||| 
Sbjct: 118 KTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREEL 177

Query:  81 CPPEKLREETCPREKLREETCPREK 105
              ..|| .  | | |      |..
Sbjct: 178 QRQKELRAQEDPGEALHSALSDRDE 202

>hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|LOC146439
        protein

          Length = 508

 Score =  31 bits (68), Expect = 0.362
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%)

Query:  25 KLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREE----TCPPEKLREET 80
           | |. . |.    ||     | |    | | | |.     ||..|        . |||| 
Sbjct: 325 KTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQSLREEL 384

Query:  81 CPPEKLREETCPREKLREETCPREK 105
              ..|| .  | | |      |..
Sbjct: 385 QRQKELRAQEDPGEALHSALSDRDE 409

>hg18||uc002cte |16|AL833749|Q658L9|Q658L9_HUMAN|DKFZp666L166|NA|NA|Hypothetical
        protein DKFZp666L166

          Length = 301

 Score =  30 bits (67), Expect = 0.472
 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query:  40 TCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPPEKLREE----TCPREK 95
           |    | |. . |     ||     | |    | | | |.     ||..|        . 
Sbjct: 113 TTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQS 172

Query:  96 LREETCPREKLREETCPREKL 116
           ||||   ...|| .  | | |
Sbjct: 173 LREELQRQKELRAQEDPGEAL 193

>hg18||uc002ctf |16|BC128602|A1A5D9|A1A5D9_HUMAN|LOC146439|NA|NA|LOC146439
        protein

          Length = 508

 Score =  30 bits (67), Expect = 0.472
 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query:  40 TCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPPEKLREE----TCPREK 95
           |    | |. . |     ||     | |    | | | |.     ||..|        . 
Sbjct: 320 TTRSPKTRKASSPQPSPPEEILEPPKKRTSLSPAEILEEKEVEVAKLQDEISLQQAELQS 379

Query:  96 LREETCPREKLREETCPREKL 116
           ||||   ...|| .  | | |
Sbjct: 380 LREELQRQKELRAQEDPGEAL 400

>hg18||uc002xpf |20|NM_080614|Q8IUB2|WFDC3_HUMAN|WFDC3|NM_080614|NP_542181|WAP
        four-disulfide core domain 3 precursor

          Length = 231

 Score =  30 bits (66), Expect = 0.617
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 10/78 (12%)

Query: 24 EKLREETCPREKLREETCHREKLREETCPPE-KLREETCPR-----EKLREETCPPEKLR 77
          |  .|  ||  |     |      .| || | |     | |      | |.  | |  .|
Sbjct: 26 EHAKEGECPPHK---NPCKELCQGDELCPAEQKCCTTGCGRICRDIPKGRKRDC-PRVIR 81

Query: 78 EETCPPEKLREETCPREK 95
          ...|    . .||||  |
Sbjct: 82 KQSCLKRCITDETCPGVK 99

>hg18||uc003tkb
        |7|NM_001129|Q8IUX7|Q8IUX7_HUMAN|AEBP1|NM_001129|NP_001120|adipocyte
        enhancer binding protein 1 precursor

          Length = 1158

 Score =  30 bits (65), Expect = 0.806
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query:  52 PPEKLREETCPREKLREETCPPEKLREETCPPEKLREETCPREKLREETCPR-EKLREET 110
           |||| ...    .| .    | | |     ||.| .|.     |  .|  |.  |  .| 
Sbjct:  86 PPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKGKEKPPKATKKPKEKPPKATKKPKEK 145

Query: 111 CPREKLREETCPPE 124
            |.   . .  ||.
Sbjct: 146 PPKATKKPKEKPPK 159

>hg18||uc001awa |1|AK057963|Q5JYW4|Q5JYW4_HUMAN|RP3-467K16.1|NA|NA|Novel protein
        (Fragment)

          Length = 473

 Score =  29 bits (64), Expect = 1.052
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query:  38 EETCHREKLREETCPPEKLREETCPR-EKLREETCPPEKLREETCPPEK--LREETCPRE 94
           ...  .|||||     ||| ||   . |||. .     .| ||    |.   .|    .|
Sbjct: 360 QQSLLQEKLREHLAEKEKLNEERLEQEEKLKAKI---RQLTEEKAALEEYITQERNRAKE 416

Query:  95 KLREETCPREKLREETCPREKLREETCPPEK 125
            | ||    ..|      ..|   ..   ||
Sbjct: 417 TLEEERKRMQELESLLAQQKKALAKSITQEK 447

>hg18||uc002uyy |2|BC118982|Q0VF49|Q0VF49_HUMAN|LOC339809|NA|NA|KIAA2012
        protein

          Length = 553

 Score =  29 bits (64), Expect = 1.052
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 2/97 (2%)

Query:  23 REKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCP 82
           ...|| .       ...   | ||||     ..   |    || |.|    .   |.   
Sbjct: 432 KQQLRLKAAQERARQQQEEFRRKLRELQRKKQQEEAERAEAEKQRQEELEMQLEEEQKHL 491

Query:  83 PEKLREETCPREKLREETCPREKLREETCPREKLREE 119
            |   ||    .. ..|    || | |   | .  ||
Sbjct: 492 MEMAEEERLEYQRRKQEA--EEKARLEAEERRQKEEE 526

>hg18||uc001hdc
        |1|NM_022731|Q9H1E3|NUCKS_HUMAN|NUCKS1|NM_022731|NP_073568|nuclear
        ubiquitous casein kinase and

          Length = 243

 Score =  28 bits (60), Expect = 3.061
 Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 5/68 (7%)

Query:  27 REETCPREKLREETC-----HREKLREETCPPEKLREETCPREKLREETCPPEKLREETC 81
           .|.  |. .|.          . |.   |       .   |.|.  |   ||||    . 
Sbjct: 165 KEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSP 224

Query:  82 PPEKLREE 89
           ||||  .|
Sbjct: 225 PPEKSGDE 232

>hg18||uc004flk |X|NM_004699|Q14320|FA50A_HUMAN|FAM50A|NM_004699|NP_004690|XAP-5
        protein

          Length = 339

 Score =  27 bits (59), Expect = 3.998
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 3/100 (3%)

Query:  21 AVREKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREET 80
           | .|. .|     |||||.   .|  |. .     | ||    |.  |     |..  | 
Sbjct:  89 AKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREE 148

Query:  81 CPPEKLREETCPREKLREETCP-REKLREETCPREKLREE 119
              .| .    |   .     | |..  ||   ||.||.|
Sbjct: 149 ITTKKRKLGKNP--DVDTSFLPDRDREEEENRLREELRQE 186

>hg18||uc004fll |X|BC000028|Q14320|FA50A_HUMAN|FAM50A|NM_004699|NP_004690|XAP-5
        protein

          Length = 339

 Score =  27 bits (59), Expect = 3.998
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 3/100 (3%)

Query:  21 AVREKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREET 80
           | .|. .|     |||||.   .|  |. .     | ||    |.  |     |..  | 
Sbjct:  89 AKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREE 148

Query:  81 CPPEKLREETCPREKLREETCP-REKLREETCPREKLREE 119
              .| .    |   .     | |..  ||   ||.||.|
Sbjct: 149 ITTKKRKLGKNP--DVDTSFLPDRDREEEENRLREELRQE 186

>hg18||uc001gbx
        |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_182581|NP_872387|hypotheti
        cal protein LOC284680

          Length = 261

 Score =  27 bits (58), Expect = 5.221
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 3/63 (4%)

Query:   9 PSQTQYEDFWCWAVREKLREETCPREKLRE---ETCHREKLREETCPPEKLREETCPREK 65
           |  . |  | |     .|     |  .  |   . |  | . |  |      | ||||| 
Sbjct:  94 PWFSPYSYFVCADKESQLEAYDFPEVQQDEGKWDNCLSEDMAENICSSSSSPENTCPREA 153

Query:  66 LRE 68
            ..
Sbjct: 154 TKK 156

>hg18||uc002uyy |2|BC118982|Q0VF49|Q0VF49_HUMAN|LOC339809|NA|NA|KIAA2012
        protein

          Length = 553

 Score =  27 bits (58), Expect = 5.221
 Identities = 20/96 (20%), Positives = 42/96 (43%)

Query:  24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
           .. .||   ...|| .       ...     ||||    ...   |    || |.|    
Sbjct: 423 QQRQEEEERKQQLRLKAAQERARQQQEEFRRKLRELQRKKQQEEAERAEAEKQRQEELEM 482

Query:  84 EKLREETCPREKLREETCPREKLREETCPREKLREE 119
           .   |.    |   ||    .. ..|   . .|  |
Sbjct: 483 QLEEEQKHLMEMAEEERLEYQRRKQEAEEKARLEAE 518

>hg18||uc001ccz |1|NM_012090|NA|NA|MACF1|NM_012090|NP_036222|microfilament and
        actin filament cross-linker

          Length = 5430

 Score =  27 bits (57), Expect = 6.819
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query:   24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
            |   ||   .   || |  |||| .     | |.|||   .|  ||      |..||   
Sbjct: 1614 EGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAV-TSALQQETEKS 1672

Query:   84 EKLREETCPREKL 96
            .  .|    ..|.
Sbjct: 1673 KAAKELAENKKKI 1685

>hg18||uc001cda |1|AF141968|NA|NA|MACF1|NM_012090|NP_036222|microfilament and
        actin filament cross-linker

          Length = 3821

 Score =  27 bits (57), Expect = 6.819
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query:   24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
            |   ||   .   || |  |||| .     | |.|||   .|  ||      |..||   
Sbjct: 1522 EGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAV-TSALQQETEKS 1580

Query:   84 EKLREETCPREKL 96
            .  .|    ..|.
Sbjct: 1581 KAAKELAENKKKI 1593

>hg18||uc001cdb |1|AB033077|NA|NA|KIAA0465|NA|NA|Homo sapiens mRNA for KIAA0465
        protein, partial cds

          Length = 1437

 Score =  27 bits (57), Expect = 6.819
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query:  24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
           |   ||   .   || |  |||| .     | |.|||   .|  ||      |..||   
Sbjct: 701 EGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAV-TSALQQETEKS 759

Query:  84 EKLREETCPREKL 96
           .  .|    ..|.
Sbjct: 760 KAAKELAENKKKI 772

>hg18||uc001cdc |1|AB007934|NA|NA|MACF1|NM_012090|NP_036222|microfilament and
        actin filament cross-linker

          Length = 2891

 Score =  27 bits (57), Expect = 6.819
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query:  24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
           |   ||   .   || |  |||| .     | |.|||   .|  ||      |..||   
Sbjct: 701 EGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAV-TSALQQETEKS 759

Query:  84 EKLREETCPREKL 96
           .  .|    ..|.
Sbjct: 760 KAAKELAENKKKI 772

>hg18||uc001cdd |1|NM_033044|NA|NA|MACF1|NM_033044|NP_149033|microfilament and
        actin filament cross-linker

          Length = 5938

 Score =  27 bits (57), Expect = 6.819
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query:   24 EKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREETCPP 83
            |   ||   .   || |  |||| .     | |.|||   .|  ||      |..||   
Sbjct: 2116 EGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAV-TSALQQETEKS 2174

Query:   84 EKLREETCPREKL 96
            .  .|    ..|.
Sbjct: 2175 KAAKELAENKKKI 2187

>hg18||uc001hdc
        |1|NM_022731|Q9H1E3|NUCKS_HUMAN|NUCKS1|NM_022731|NP_073568|nuclear
        ubiquitous casein kinase and

          Length = 243

 Score =  27 bits (57), Expect = 6.819
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query:  54 EKLREETCPREKLREETCPPEKLREETCPPE-----KLREETCPREKLREETCPREKLRE 108
           .|. ... |  |  |.  |  .|.    |       |.   |  .    .   |.|.  |
Sbjct: 154 KKMVKKSKPERK--EKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEE 211

Query: 109 ETCPREKLREETCPPEK 125
              | ||    . ||||
Sbjct: 212 PESPPEKKTSTSPPPEK 228

>hg18||uc002fmx
        |16|NM_013275|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275|NP_037407|ankyrin
        repeat domain 11

          Length = 2663

 Score =  27 bits (57), Expect = 6.819
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query:   70 TCPP--EKLREETCPPEKLREETCPR--EKLREETCPREKLREETCPREKLREE 119
            | ||  .| ||  | ||||.|.   |      ...  ||. ..|   ...  |.
Sbjct: 1326 TEPPGDDKPRESACLPEKLKEKERHRHSSSSSKKSHDRERAKKEKAEKKEKGED 1379

>hg18||uc002fmy
        |16|AY533563|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275|NP_037407|ankyrin
        repeat domain 11

          Length = 2663

 Score =  27 bits (57), Expect = 6.819
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query:   70 TCPP--EKLREETCPPEKLREETCPR--EKLREETCPREKLREETCPREKLREE 119
            | ||  .| ||  | ||||.|.   |      ...  ||. ..|   ...  |.
Sbjct: 1326 TEPPGDDKPRESACLPEKLKEKERHRHSSSSSKKSHDRERAKKEKAEKKEKGED 1379

>hg18||uc002fnb
        |16|AK025964|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275|NP_037407|ankyrin
        repeat domain 11

          Length = 2447

 Score =  27 bits (57), Expect = 6.819
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query:   70 TCPP--EKLREETCPPEKLREETCPR--EKLREETCPREKLREETCPREKLREE 119
            | ||  .| ||  | ||||.|.   |      ...  ||. ..|   ...  |.
Sbjct: 1283 TEPPGDDKPRESACLPEKLKEKERHRHSSSSSKKSHDRERAKKEKAEKKEKGED 1336

>hg18||uc002fnc
        |16|BC069013|Q6UB99|ANR11_HUMAN|ANKRD11|NM_013275|NP_037407|ankyrin
        repeat domain 11

          Length = 2490

 Score =  27 bits (57), Expect = 6.819
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query:   70 TCPP--EKLREETCPPEKLREETCPR--EKLREETCPREKLREETCPREKLREE 119
            | ||  .| ||  | ||||.|.   |      ...  ||. ..|   ...  |.
Sbjct: 1326 TEPPGDDKPRESACLPEKLKEKERHRHSSSSSKKSHDRERAKKEKAEKKEKGED 1379

>hg18||uc003sps |7|NM_032172|NA|NA|USP42|NM_032172|NP_115548|ubiquitin specific
        protease 42

          Length = 1316

 Score =  27 bits (57), Expect = 6.819
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query:  92 PREKLREETCPREKLREETCPREKLREETCPPE 124
           |  . | .|      |  |||||. |..   ||
Sbjct: 965 PARESRSKTEGHRHRRRRTCPRERDRQDRHAPE 997

>hg18||uc001ehk
        |1|NM_206996|Q6Q759|Q6Q759_HUMAN|SPAG17|NM_206996|NP_996879|projection
        protein PF6

          Length = 2223

 Score =  26 bits (56), Expect = 8.906
 Identities = 17/60 (28%), Positives = 31/60 (51%)

Query:   21 AVREKLREETCPREKLREETCHREKLREETCPPEKLREETCPREKLREETCPPEKLREET 80
            |  |.||||    .| .|    . |   |      |....  .|| .||    ... ||.
Sbjct:  948 AEEERLREEKKAEKKGKEAGKKKGKDNAEKEDSRSLKKKSPYKEKSKEEQVKIQEVTEES 1007

>hg18||uc001gbx
        |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_182581|NP_872387|hypotheti
        cal protein LOC284680

          Length = 261

 Score =  26 bits (56), Expect = 8.906
 Identities = 10/30 (33%), Positives = 14/30 (46%)

Query:  69 ETCPPEKLREETCPPEKLREETCPREKLRE 98
           . |  | . |  |      | |||||  ..
Sbjct: 127 DNCLSEDMAENICSSSSSPENTCPREATKK 156

>hg18||uc001gbx
        |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_182581|NP_872387|hypotheti
        cal protein LOC284680

          Length = 261

 Score =  26 bits (56), Expect = 8.906
 Identities = 10/30 (33%), Positives = 14/30 (46%)

Query:  79 ETCPPEKLREETCPREKLREETCPREKLRE 108
           . |  | . |  |      | |||||  ..
Sbjct: 127 DNCLSEDMAENICSSSSSPENTCPREATKK 156

>hg18||uc001gbx
        |1|NM_182581|Q5T0L3|Q5T0L3_HUMAN|C1orf111|NM_182581|NP_872387|hypotheti
        cal protein LOC284680

          Length = 261

 Score =  26 bits (56), Expect = 8.906
 Identities = 10/30 (33%), Positives = 14/30 (46%)

Query:  89 ETCPREKLREETCPREKLREETCPREKLRE 118
           . |  | . |  |      | |||||  ..
Sbjct: 127 DNCLSEDMAENICSSSSSPENTCPREATKK 156

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,827,316
Number of Sequences: 45480
Number of Extensions: 191827316
Number of Successful Extensions: 11130448
Number of sequences better than 0.0: 0
BLASTP 7.6.0