BLASTP 7.6.0


Query=fugu4_747345 |jgi|Takru4|747345|fgh5_pg.C_scaffold_5608000001
        (124 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001zys |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|...    155   8e-039
hg18||uc001zyt |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|N...    155   8e-039
hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|tran...    155   8e-039
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    151   1e-037
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    151   1e-037
hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channe...    151   1e-037
hg18||uc004ahu |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_...    146   4e-036
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    146   4e-036
hg18||uc004ahw |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|N...    146   4e-036
hg18||uc004ahx |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP...    146   4e-036
hg18||uc004ahy |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP...    146   4e-036
hg18||uc004ahz |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP...    146   4e-036
hg18||uc004aia |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP...    146   4e-036
hg18||uc004aib |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP...    146   4e-036
hg18||uc004aic |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_00100747...    146   4e-036
hg18||uc004aid |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007...    146   4e-036
hg18||uc001zfm |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420...    142   7e-035
hg18||uc002pmw |19|NM_017636|Q8TD43|TRPM4_HUMAN|TRPM4|NM_017636|...     67   3e-012
hg18||uc002pmx |19|AY046396|Q8TD43-2|Q8TD43-2|TRPM4|NA|NA|Transi...     67   3e-012
hg18||uc002zet |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...     67   3e-012
hg18||uc002zeu |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...     67   3e-012
hg18||uc002zev |21|NM_001001188|O94759-3|O94759-3|TRPM2|NM_00100...     67   3e-012
hg18||uc002zew |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|...     67   3e-012
hg18||uc002zex |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|...     67   3e-012
hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|tran...     67   3e-012
hg18||uc002slu |2|BC045536|Q86XF2|Q86XF2_HUMAN|TTC31|NA|NA|TTC31...     27   3.405
hg18||uc003sni |7|AK000997|Q96JH8-2|Q96JH8-2|KIAA1849|NA|NA|Prot...     26   5.808
hg18||uc003snj |7|NM_018059|Q0VFZ9|Q0VFZ9_HUMAN|FLJ10324|NM_0180...     26   5.808
hg18||uc001khr |10|NM_003972|O14981|BTAF1_HUMAN|BTAF1|NM_003972|...     25   9.907
hg18||uc001khs |10|BC030273|NA|NA|TAF-172|NA|NA|Homo sapiens mRN...     25   9.907

>hg18||uc001zys
        |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1864

 Score =  155 bits (391), Expect = 8e-039
 Identities = 74/124 (59%), Positives = 99/124 (79%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           || |||  |||..|.|  ||..|||||.||..| . | |.| |.  | .||||||.||. 
Sbjct: 637 MARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQ 696

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .| |.| ||||||| |.. ||. |||..||||  ||||.|.||| ||.|.| | ||||||
Sbjct: 697 SFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKN 756

Query: 121 SSLK 124
           |  |
Sbjct: 757 SWYK 760

>hg18||uc001zyt
        |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1865

 Score =  155 bits (391), Expect = 8e-039
 Identities = 74/124 (59%), Positives = 99/124 (79%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           || |||  |||..|.|  ||..|||||.||..| . | |.| |.  | .||||||.||. 
Sbjct: 637 MARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQ 696

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .| |.| ||||||| |.. ||. |||..||||  ||||.|.||| ||.|.| | ||||||
Sbjct: 697 SFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKN 756

Query: 121 SSLK 124
           |  |
Sbjct: 757 SWYK 760

>hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|transient receptor
        potential cation channel,

          Length = 556

 Score =  155 bits (391), Expect = 8e-039
 Identities = 74/124 (59%), Positives = 99/124 (79%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           || |||  |||..|.|  ||..|||||.||..| . | |.| |.  | .||||||.||. 
Sbjct: 195 MARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQ 254

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .| |.| ||||||| |.. ||. |||..||||  ||||.|.||| ||.|.| | ||||||
Sbjct: 255 SFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKN 314

Query: 121 SSLK 124
           |  |
Sbjct: 315 SWYK 318

>hg18||uc004ajk
        |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2017

 Score =  151 bits (381), Expect = 1e-037
 Identities = 75/124 (60%), Positives = 91/124 (73%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.| |  ||||  .|  || |||.|| ||. | | |  .| |.  | .|||||.|||. 
Sbjct: 618 MAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEK 677

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           || |||.||| ||| |.  ||. |||..|||   ||||||.||| ||||.| | | ||||
Sbjct: 678 AFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKN 737

Query: 121 SSLK 124
           | ||
Sbjct: 738 SWLK 741

>hg18||uc004ajl
        |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2022

 Score =  151 bits (381), Expect = 1e-037
 Identities = 75/124 (60%), Positives = 91/124 (73%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.| |  ||||  .|  || |||.|| ||. | | |  .| |.  | .|||||.|||. 
Sbjct: 623 MAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEK 682

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           || |||.||| ||| |.  ||. |||..|||   ||||||.||| ||||.| | | ||||
Sbjct: 683 AFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKN 742

Query: 121 SSLK 124
           | ||
Sbjct: 743 SWLK 746

>hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channel kinase 2
        (CHAK2) mRNA, complete cds

          Length = 350

 Score =  151 bits (381), Expect = 1e-037
 Identities = 75/124 (60%), Positives = 91/124 (73%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.| |  ||||  .|  || |||.|| ||. | | |  .| |.  | .|||||.|||. 
Sbjct:   1 MAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEK 60

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           || |||.||| ||| |.  ||. |||..|||   ||||||.||| ||||.| | | ||||
Sbjct:  61 AFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKN 120

Query: 121 SSLK 124
           | ||
Sbjct: 121 SWLK 124

>hg18||uc004ahu
        |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1549

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 481 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 540

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 541 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 600

Query: 121 SSLK 124
           | ||
Sbjct: 601 SGLK 604

>hg18||uc004ahv
        |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1509

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 453 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 512

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 513 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 572

Query: 121 SSLK 124
           | ||
Sbjct: 573 SGLK 576

>hg18||uc004ahw
        |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|NP_996829|transient
        receptor potential cation channel,

          Length = 1579

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 523 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 582

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 583 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 642

Query: 121 SSLK 124
           | ||
Sbjct: 643 SGLK 646

>hg18||uc004ahx
        |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1566

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 510 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 569

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 570 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 629

Query: 121 SSLK 124
           | ||
Sbjct: 630 SGLK 633

>hg18||uc004ahy
        |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP_996830|transient
        receptor potential cation channel,

          Length = 1569

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 513 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 572

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 573 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 632

Query: 121 SSLK 124
           | ||
Sbjct: 633 SGLK 636

>hg18||uc004ahz
        |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP_996828|transient
        receptor potential cation channel,

          Length = 1556

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 500 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 559

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 560 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 619

Query: 121 SSLK 124
           | ||
Sbjct: 620 SGLK 623

>hg18||uc004aia
        |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP_066003|transient
        receptor potential cation channel,

          Length = 1554

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 498 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 557

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 558 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 617

Query: 121 SSLK 124
           | ||
Sbjct: 618 SGLK 621

>hg18||uc004aib
        |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1544

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 488 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 547

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 548 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 607

Query: 121 SSLK 124
           | ||
Sbjct: 608 SGLK 611

>hg18||uc004aic
        |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_001007471|NP_001007472|transie
        nt receptor potential cation channel,

          Length = 1325

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 651 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 710

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 711 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 770

Query: 121 SSLK 124
           | ||
Sbjct: 771 SGLK 774

>hg18||uc004aid
        |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007471|NP_001007472|trans
        ient receptor potential cation channel,

          Length = 1707

 Score =  146 bits (368), Expect = 4e-036
 Identities = 69/124 (55%), Positives = 94/124 (75%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           |||| |  ||||.|.|  ||.| ..|| ||  . | |  .. |   | .||||||.||| 
Sbjct: 651 MALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQ 710

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           .. |.||.|||||| |.. ||. ||||.||.. || |..|.|.| ||||.| | | ||||
Sbjct: 711 SYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 770

Query: 121 SSLK 124
           | ||
Sbjct: 771 SGLK 774

>hg18||uc001zfm
        |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420|NP_002411|transient
        receptor potential cation channel,

          Length = 1603

 Score =  142 bits (357), Expect = 7e-035
 Identities = 65/124 (52%), Positives = 95/124 (76%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.||| ||||..|.|  ||.||..|| |.  | . |  .. |   | .|||||..||| 
Sbjct: 627 MAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQ 686

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNMRKN 120
           ..  .||.|||||| |.. ||. |||..||.. || |..|.|.| ||||.| | | ||||
Sbjct: 687 SYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKN 746

Query: 121 SSLK 124
             ||
Sbjct: 747 PGLK 750

>hg18||uc002pmw
        |19|NM_017636|Q8TD43|TRPM4_HUMAN|TRPM4|NM_017636|NP_060106|transient
        receptor potential cation channel,

          Length = 1214

 Score =  67 bits (162), Expect = 3e-012
 Identities = 38/115 (33%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.. |  |  |.. |  || | | ||    |   |   | | .  . .|  . |||   
Sbjct: 574 MAMYFWEMGSNAVSSALGACLLLRVMA----RLEPDAEEAARRKDLAFKFEGMGVDLFGE 629

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPL 115
            .  .|  | .||      |   ||||.|. .  | | .    |.|||  | | .
Sbjct: 630 CYRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQDGVQSLLTQKWWGDM 684

>hg18||uc002pmx |19|AY046396|Q8TD43-2|Q8TD43-2|TRPM4|NA|NA|Transient receptor
        potential cation channel subfamily M member 4 (Long transient receptor
        potential channel 4) (hTRPM4) (Melastatin-4) (Calcium-activated
        non-selective cation channel 1)

          Length = 1040

 Score =  67 bits (162), Expect = 3e-012
 Identities = 38/115 (33%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           ||.. |  |  |.. |  || | | ||    |   |   | | .  . .|  . |||   
Sbjct: 400 MAMYFWEMGSNAVSSALGACLLLRVMA----RLEPDAEEAARRKDLAFKFEGMGVDLFGE 455

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPL 115
            .  .|  | .||      |   ||||.|. .  | | .    |.|||  | | .
Sbjct: 456 CYRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQDGVQSLLTQKWWGDM 510

>hg18||uc002zet
        |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 637 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 692

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 693 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 749

>hg18||uc002zeu
        |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 637 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 692

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 693 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 749

>hg18||uc002zev
        |21|NM_001001188|O94759-3|O94759-3|TRPM2|NM_001001188|NP_001001188|tran
        sient receptor potential cation channel,

          Length = 846

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 637 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 692

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 693 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 749

>hg18||uc002zew
        |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 637 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 692

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 693 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 749

>hg18||uc002zex
        |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1289

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 423 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 478

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 479 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 535

>hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|transient receptor
        potential cation channel,

          Length = 982

 Score =  67 bits (162), Expect = 3e-012
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEARRSSMDDSTAERLRTCSLEFGQLAVDLLDV 60
           .|  .| . .. .| | |  .. . .. |      |  ..| .   . |.   |. .   
Sbjct: 150 LAGIIWAQSQDCIAAALACSKILKELSKEEE----DTDSSEEMLALAEEYEHRAIGVFTE 205

Query:  61 AFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHRPFVSHSCTQTLLTDLWSGPLNM 117
            . ..|. | ||||   |||   ||||.|. .    ||||   |  || .| | |..
Sbjct: 206 CYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSV 262

>hg18||uc002slu |2|BC045536|Q86XF2|Q86XF2_HUMAN|TTC31|NA|NA|TTC31 protein
        (Fragment)

          Length = 373

 Score =  27 bits (58), Expect = 3.405
 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%)

Query:   6 WPRGEEALARATAACQLYRSMAF---EARRSSMDDSTAERLRTCSL 48
           ||||   | .|    | .|  |    |  |       |  ||.| |
Sbjct: 226 WPRGLFRLGKALMGLQRFREAAAVFQETLRGGSQPDAARELRSCLL 271

>hg18||uc003sni |7|AK000997|Q96JH8-2|Q96JH8-2|KIAA1849|NA|NA|Protein KIAA1849

          Length = 580

 Score =  26 bits (56), Expect = 5.808
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEA 30
           .. | |||| .| ||     .  ||  | |
Sbjct: 164 LSCFHWPRGVQACARLQQLLEWMRSAGFGA 193

>hg18||uc003snj
        |7|NM_018059|Q0VFZ9|Q0VFZ9_HUMAN|FLJ10324|NM_018059|NP_060529|hypotheti
        cal protein LOC55698

          Length = 1075

 Score =  26 bits (56), Expect = 5.808
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query:   1 MALFLWPRGEEALARATAACQLYRSMAFEA 30
           .. | |||| .| ||     .  ||  | |
Sbjct: 659 LSCFHWPRGVQACARLQQLLEWMRSAGFGA 688

>hg18||uc001khr |10|NM_003972|O14981|BTAF1_HUMAN|BTAF1|NM_003972|NP_003963|BTAF1
        RNA polymerase II, B-TFIID transcription

          Length = 1849

 Score =  25 bits (54), Expect = 9.907
 Identities = 18/78 (23%), Positives = 32/78 (41%)

Query:  36 DDSTAERLRTCSLEFGQLAVDLLDVAFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHR 95
           |.  |    ||.   | .   . .   |.   . .|||| |     |   | .  .   |
Sbjct: 361 DEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR 420

Query:  96 PFVSHSCTQTLLTDLWSG 113
             | ..    .|| .  |
Sbjct: 421 QDVINTLLPKVLTRIIEG 438

>hg18||uc001khs |10|BC030273|NA|NA|TAF-172|NA|NA|Homo sapiens mRNA for BTAF1 RNA
        polymerase II, B-TFIID transcription factor-associated, 170kDa variant
        protein

          Length = 621

 Score =  25 bits (54), Expect = 9.907
 Identities = 18/78 (23%), Positives = 32/78 (41%)

Query:  36 DDSTAERLRTCSLEFGQLAVDLLDVAFHQNEQMAMKLLTSEMEAWSHFTCLQMAVSSCHR 95
           |.  |    ||.   | .   . .   |.   . .|||| |     |   | .  .   |
Sbjct:  31 DEVVAPVRETCAQTLGVVLKHMNETGVHKTVDVLLKLLTQEQWEVRHGGLLGIKYALAVR 90

Query:  96 PFVSHSCTQTLLTDLWSG 113
             | ..    .|| .  |
Sbjct:  91 QDVINTLLPKVLTRIIEG 108

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0