BLASTP 7.6.0


Query=fugu4_747284 |jgi|Takru4|747284|fgh5_pg.C_scaffold_5355000001
        (110 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc004ahu |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_...    204   2e-053
hg18||uc004ahv |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_...    204   2e-053
hg18||uc004ahw |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|N...    204   2e-053
hg18||uc004ahx |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP...    204   2e-053
hg18||uc004ahy |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP...    204   2e-053
hg18||uc004ahz |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP...    204   2e-053
hg18||uc004aia |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP...    204   2e-053
hg18||uc004aib |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP...    204   2e-053
hg18||uc004aic |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_00100747...    204   2e-053
hg18||uc004aid |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007...    204   2e-053
hg18||uc001zfm |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420...    183   3e-047
hg18||uc004ajk |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_...    143   3e-035
hg18||uc004ajl |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|N...    143   3e-035
hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channe...    114   3e-026
hg18||uc001zys |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|...     83   4e-017
hg18||uc001zyt |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|N...     83   4e-017
hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|tran...     83   4e-017
hg18||uc001zys |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|...     62   1e-010
hg18||uc001zyt |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|N...     62   1e-010
hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|tran...     62   1e-010
hg18||uc002zet |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...     62   1e-010
hg18||uc002zeu |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|N...     62   1e-010
hg18||uc002zew |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|...     62   1e-010
hg18||uc002zex |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|...     62   1e-010
hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|tran...     62   1e-010
hg18||uc002vvh |2|NM_024080|Q3YFM7|Q3YFM7_HUMAN|TRPM8|NM_024080|...     54   3e-008

>hg18||uc004ahu
        |9|AF536750|Q9HCF6-6|Q9HCF6-6|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1549

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 725 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 784

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 785 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 834

>hg18||uc004ahv
        |9|AB099665|Q9HCF6-8|Q9HCF6-8|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1509

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 697 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 756

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 757 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 806

>hg18||uc004ahw
        |9|NM_206946|Q9HCF6|TRPM3_HUMAN|TRPM3|NM_206946|NP_996829|transient
        receptor potential cation channel,

          Length = 1579

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 767 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 826

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 827 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 876

>hg18||uc004ahx
        |9|NM_024971|Q9HCF6-3|Q9HCF6-3|TRPM3|NM_024971|NP_079247|transient
        receptor potential cation channel,

          Length = 1566

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 754 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 813

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 814 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 863

>hg18||uc004ahy
        |9|NM_206947|Q9HCF6-7|Q9HCF6-7|TRPM3|NM_206947|NP_996830|transient
        receptor potential cation channel,

          Length = 1569

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 757 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 816

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 817 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 866

>hg18||uc004ahz
        |9|NM_206945|Q9HCF6-5|Q9HCF6-5|TRPM3|NM_206945|NP_996828|transient
        receptor potential cation channel,

          Length = 1556

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 744 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 803

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 804 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 853

>hg18||uc004aia
        |9|NM_020952|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_020952|NP_066003|transient
        receptor potential cation channel,

          Length = 1554

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 742 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 801

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 802 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 851

>hg18||uc004aib
        |9|NM_206944|Q9HCF6-4|Q9HCF6-4|TRPM3|NM_206944|NP_996827|transient
        receptor potential cation channel,

          Length = 1544

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct: 732 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 791

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct: 792 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 841

>hg18||uc004aic
        |9|AJ505026|Q9HCF6-10|Q9HCF6-10|TRPM3|NM_001007471|NP_001007472|transie
        nt receptor potential cation channel,

          Length = 1325

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:    1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
            |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct:  895 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 954

Query:   61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
            ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct:  955 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 1004

>hg18||uc004aid
        |9|NM_001007471|Q9HCF6-9|Q9HCF6-9|TRPM3|NM_001007471|NP_001007472|trans
        ient receptor potential cation channel,

          Length = 1707

 Score =  204 bits (517), Expect = 2e-053
 Identities = 96/110 (87%), Positives = 103/110 (93%)

Query:    1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
            |. ||| ||||||||||| |||||||||||||||||||||||||||||.|||.|||.|||
Sbjct:  895 MERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSV 954

Query:   61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
            ||.||||. |  | |||||||||||||||||.||||||||||||||||||
Sbjct:  955 GMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKM 1004

>hg18||uc001zfm
        |15|NM_002420|Q7Z4N5|Q7Z4N5_HUMAN|TRPM1|NM_002420|NP_002411|transient
        receptor potential cation channel,

          Length = 1603

 Score =  183 bits (464), Expect = 3e-047
 Identities = 85/110 (77%), Positives = 96/110 (87%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           || ||| ||||||||| .  .||.||||||||||| ||.|||||||||||||.||  | .
Sbjct: 853 MDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISTFMI 912

Query:  61 GMVLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           | .||||  | | ||||||||.||.||||.|.||||||||||||||||||
Sbjct: 913 GAILRLQNQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKM 962

>hg18||uc004ajk
        |9|AY333284|Q9BX84-3|Q9BX84-3|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2017

 Score =  143 bits (360), Expect = 3e-035
 Identities = 64/106 (60%), Positives = 82/106 (77%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVL 64
           || |||.|  ||||| || .||| .|||||  ||||||. ||||.|. .|| .|| | ||
Sbjct: 863 PSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVL 922

Query:  65 RLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           |  .||  . ||.|||..||.|. |||. | ||.. |||| || ||
Sbjct: 923 RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKM 968

>hg18||uc004ajl
        |9|NM_017662|Q9BX84|TRPM6_HUMAN|TRPM6|NM_017662|NP_060132|transient
        receptor potential cation channel,

          Length = 2022

 Score =  143 bits (360), Expect = 3e-035
 Identities = 64/106 (60%), Positives = 82/106 (77%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVL 64
           || |||.|  ||||| || .||| .|||||  ||||||. ||||.|. .|| .|| | ||
Sbjct: 868 PSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVL 927

Query:  65 RLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           |  .||  . ||.|||..||.|. |||. | ||.. |||| || ||
Sbjct: 928 RWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKM 973

>hg18||uc004ajm |9|CR618713|NA|NA|CHAK2|NA|NA|Homo sapiens channel kinase 2
        (CHAK2) mRNA, complete cds

          Length = 350

 Score =  114 bits (283), Expect = 3e-026
 Identities = 50/89 (56%), Positives = 66/89 (74%)

Query:  22 EKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSVGMVLRLQEPPLMSYGRVIYCV 81
           |    | .|||||  ||||||. ||||.|. .|| .|| | |||  .||  . ||.|||.
Sbjct: 171 ESASVICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLRWGDPPFHTAGRLIYCI 230

Query:  82 NIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           .||.|. |||. | ||.. |||| || ||
Sbjct: 231 DIIFWFSRLLDFFAVNQHAGPYVTMIAKM 259

>hg18||uc001zys
        |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1864

 Score =  83 bits (204), Expect = 4e-017
 Identities = 39/65 (60%), Positives = 50/65 (76%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |.  || ||||||.||||  |||.||| ||| ||. ||.|||  .|.||.| .||. | .
Sbjct: 878 MEQLPSVQEWIVIAYIFTYAIEKVREIFMSEAGKVNQKIKVWFSDYFNISDTIAIISFFI 937

Query:  61 GMVLR 65
           |  ||
Sbjct: 938 GFGLR 942

>hg18||uc001zyt
        |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1865

 Score =  83 bits (204), Expect = 4e-017
 Identities = 39/65 (60%), Positives = 50/65 (76%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |.  || ||||||.||||  |||.||| ||| ||. ||.|||  .|.||.| .||. | .
Sbjct: 878 MEQLPSVQEWIVIAYIFTYAIEKVREIFMSEAGKVNQKIKVWFSDYFNISDTIAIISFFI 937

Query:  61 GMVLR 65
           |  ||
Sbjct: 938 GFGLR 942

>hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|transient receptor
        potential cation channel,

          Length = 556

 Score =  83 bits (204), Expect = 4e-017
 Identities = 39/65 (60%), Positives = 50/65 (76%)

Query:   1 MDLWPSPQEWIVISYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSV 60
           |.  || ||||||.||||  |||.||| ||| ||. ||.|||  .|.||.| .||. | .
Sbjct: 436 MEQLPSVQEWIVIAYIFTYAIEKVREIFMSEAGKVNQKIKVWFSDYFNISDTIAIISFFI 495

Query:  61 GMVLR 65
           |  ||
Sbjct: 496 GFGLR 500

>hg18||uc001zys
        |15|NM_017672|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1864

 Score =  62 bits (149), Expect = 1e-010
 Identities = 25/36 (69%), Positives = 31/36 (86%)

Query:  75 GRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.|||.|||.||.|||.   ||.  ||||||||||
Sbjct: 961 GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKM 996

>hg18||uc001zyt
        |15|AY032950|Q96QT4|TRPM7_HUMAN|TRPM7|NM_017672|NP_060142|transient
        receptor potential cation channel,

          Length = 1865

 Score =  62 bits (149), Expect = 1e-010
 Identities = 25/36 (69%), Positives = 31/36 (86%)

Query:  75 GRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.|||.|||.||.|||.   ||.  ||||||||||
Sbjct: 961 GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKM 996

>hg18||uc001zyu |15|BC051024|NA|NA|TRPM7|NM_017672|NP_060142|transient receptor
        potential cation channel,

          Length = 556

 Score =  62 bits (149), Expect = 1e-010
 Identities = 25/36 (69%), Positives = 31/36 (86%)

Query:  75 GRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
           ||.|||.|||.||.|||.   ||.  ||||||||||
Sbjct: 519 GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKM 554

>hg18||uc002zet
        |21|AB166745|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  62 bits (148), Expect = 1e-010
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGK--LLQKVKVWLQEYWNITDLMAILIFSVGM 62
           ||  |  .  ..|.   |.||. |  .| .  |..|  ..  ..||  |. |||.|  |.
Sbjct: 825 PSWCECAIYLWLFSLVCEEMRQ-LFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGL 883

Query:  63 VLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
             ||  |  .  ||||  .. | . .||. || ..| ||| .... .|
Sbjct: 884 TCRL-IPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRM 930

>hg18||uc002zeu
        |21|AB001535|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  62 bits (148), Expect = 1e-010
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGK--LLQKVKVWLQEYWNITDLMAILIFSVGM 62
           ||  |  .  ..|.   |.||. |  .| .  |..|  ..  ..||  |. |||.|  |.
Sbjct: 825 PSWCECAIYLWLFSLVCEEMRQ-LFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGL 883

Query:  63 VLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
             ||  |  .  ||||  .. | . .||. || ..| ||| .... .|
Sbjct: 884 TCRL-IPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRM 930

>hg18||uc002zew
        |21|NM_003307|O94759|TRPM2_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1503

 Score =  62 bits (148), Expect = 1e-010
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGK--LLQKVKVWLQEYWNITDLMAILIFSVGM 62
           ||  |  .  ..|.   |.||. |  .| .  |..|  ..  ..||  |. |||.|  |.
Sbjct: 825 PSWCECAIYLWLFSLVCEEMRQ-LFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGL 883

Query:  63 VLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
             ||  |  .  ||||  .. | . .||. || ..| ||| .... .|
Sbjct: 884 TCRL-IPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRM 930

>hg18||uc002zex
        |21|AB166746|Q5KTC1|Q5KTC1_HUMAN|TRPM2|NM_003307|NP_003298|transient
        receptor potential cation channel,

          Length = 1289

 Score =  62 bits (148), Expect = 1e-010
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGK--LLQKVKVWLQEYWNITDLMAILIFSVGM 62
           ||  |  .  ..|.   |.||. |  .| .  |..|  ..  ..||  |. |||.|  |.
Sbjct: 611 PSWCECAIYLWLFSLVCEEMRQ-LFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGL 669

Query:  63 VLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
             ||  |  .  ||||  .. | . .||. || ..| ||| .... .|
Sbjct: 670 TCRL-IPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRM 716

>hg18||uc002zey |21|AJ417076|NA|NA|TRPM2|NM_003307|NP_003298|transient receptor
        potential cation channel,

          Length = 982

 Score =  62 bits (148), Expect = 1e-010
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query:   5 PSPQEWIVISYIFTNGIEKMREILMSEPGK--LLQKVKVWLQEYWNITDLMAILIFSVGM 62
           ||  |  .  ..|.   |.||. |  .| .  |..|  ..  ..||  |. |||.|  |.
Sbjct: 338 PSWCECAIYLWLFSLVCEEMRQ-LFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGL 396

Query:  63 VLRLQEPPLMSYGRVIYCVNIIYWYIRLLEIFGVNKYLGPYVMMIGKM 110
             ||  |  .  ||||  .. | . .||. || ..| ||| .... .|
Sbjct: 397 TCRL-IPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRM 443

>hg18||uc002vvh
        |2|NM_024080|Q3YFM7|Q3YFM7_HUMAN|TRPM8|NM_024080|NP_076985|transient
        receptor potential cation channel,

          Length = 1104

 Score =  54 bits (128), Expect = 3e-008
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query:  42 WLQEYWNITDLMAILIFSVGMVLRLQEPPLMSY--GRVIYCVNIIYWYIRLLEIFGVNKY 99
           .  . ||. | . .  |  |.| ||      |   ||||.|.. | . .||. || |.. 
Sbjct: 793 YFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFTLRLIHIFTVSRN 852

Query: 100 LGPYVMMIGKM 110
           ||| ..|. .|
Sbjct: 853 LGPKIIMLQRM 863

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0