BLASTP 7.6.0


Query=fugu4_747201 |jgi|Takru4|747201|fgh5_pg.C_scaffold_5081000001
        (136 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002hqs |17|NM_003559|P78356|PI52B_HUMAN|PIP5K2B|NM_00355...     98   2e-021
hg18||uc001irl |10|NM_005028|P48426|PI52A_HUMAN|PIP5K2A|NM_00502...     77   4e-015
hg18||uc002hqs |17|NM_003559|P78356|PI52B_HUMAN|PIP5K2B|NM_00355...     70   5e-013
hg18||uc002hqt |17|BC027459|P78356-2|P78356-2|PIP5K2B|NM_003559|...     70   5e-013
hg18||uc001irl |10|NM_005028|P48426|PI52A_HUMAN|PIP5K2A|NM_00502...     65   3e-011
hg18||uc001sot |12|NM_024779|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_0247...     63   8e-011
hg18||uc001sou |12|AK075553|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_02477...     63   8e-011
hg18||uc001sot |12|NM_024779|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_0247...     58   3e-009
hg18||uc001sou |12|AK075553|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_02477...     58   3e-009
hg18||uc001exi |1|NM_003557|Q99755-3|Q99755-3|PIP5K1A|NM_003557|...     32   0.148
hg18||uc001exj |1|U78576|Q99755|PI51A_HUMAN|PIP5K1A|NM_003557|NP...     32   0.148
hg18||uc001exk |1|U78577|Q99755-2|Q99755-2|PIP5K1A|NM_003557|NP_...     32   0.148
hg18||uc002lyj |19|NM_012398|O60331|PI51C_HUMAN|PIP5K1C|NM_01239...     32   0.148
hg18||uc004agu |9|NM_003558|O14986|PI51B_HUMAN|PIP5K1B|NM_003558...     32   0.252
hg18||uc003cxf |3|NM_001640|P13798|ACPH_HUMAN|APEH|NM_001640|NP_...     30   0.733
hg18||uc003mxx |6|DQ577059|Q8TBY6|Q8TBY6_HUMAN|MGC26597|NA|NA|MG...     29   1.251
hg18||uc002ibj |17|NM_032387|Q96J92|WNK4_HUMAN|WNK4|NM_032387|NP...     28   3.639
hg18||uc002ibk |17|AK096052|NA|NA|WNK4|NM_032387|NP_115763|WNK l...     28   3.639
hg18||uc003fsk |3|NM_134470|Q9NPH3-2|Q9NPH3-2|IL1RAP|NM_134470|N...     27   6.206
hg18||uc003fsl |3|AF538732|Q9NPH3-2|Q9NPH3-2|IL1RAP|NM_134470|NP...     27   6.206
hg18||uc003fsm |3|NM_002182|Q9NPH3|IL1AP_HUMAN|IL1RAP|NM_002182|...     27   6.206
hg18||uc003fso |3|AF538733|Q9NPH3|IL1AP_HUMAN|IL1RAP|NM_002182|N...     27   6.206

>hg18||uc002hqs
        |17|NM_003559|P78356|PI52B_HUMAN|PIP5K2B|NM_003559|NP_003550|phosphatid
        ylinositol-4-phosphate 5-kinase type

          Length = 416

 Score =  98 bits (243), Expect = 2e-021
 Identities = 52/88 (59%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query:  49 QFLATLKIMDYSLLVGIHDVDRAXXXXXXXXXXXXXXXXXXXXMGGGVLTGSFGTPPDSP 108
           .||| ||||||||||||||||||                    .|| .|  |.|||||||
Sbjct: 269 EFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLC-SYGTPPDSP 327

Query: 109 GNPLNCGGFFGPGEFDSSVDVYAIKSHD 136
           || |.   |||||||| ||||||.|||.
Sbjct: 328 GNLLSFPRFFGPGEFDPSVDVYAMKSHE 355

>hg18||uc001irl
        |10|NM_005028|P48426|PI52A_HUMAN|PIP5K2A|NM_005028|NP_005019|phosphatid
        ylinositol-4-phosphate 5-kinase type

          Length = 406

 Score =  77 bits (189), Expect = 4e-015
 Identities = 49/122 (40%), Positives = 60/122 (49%), Gaps = 10/122 (8%)

Query:  19 VPVMLMPDDFKAYSKIKVDNH----LFNNLAVWFQFLATLKIMDYSLLVGIHDVDRAXXX 74
           .| .   |      || .|..        |    .||| ||.||||||||||||.||   
Sbjct: 230 LPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQE 289

Query:  75 XXXXXXXXXXXXXXXXXMGGGVLTGSFGTPPDSPGNPLNCGGFFGPGEFDSSVDVYAIKS 134
                             |    |   ||||||||| ||      ||||| ..||| || 
Sbjct: 290 EVECEENDGEEE------GESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKC 343

Query: 135 HD 136
           |.
Sbjct: 344 HE 345

>hg18||uc002hqs
        |17|NM_003559|P78356|PI52B_HUMAN|PIP5K2B|NM_003559|NP_003550|phosphatid
        ylinositol-4-phosphate 5-kinase type

          Length = 416

 Score =  70 bits (171), Expect = 5e-013
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 2/42 (4%)

Query: 11 VNELSNVPVPVMLMPDDFKAYSKIKVDNHLFN--NLAVWFQF 50
          .|||||||||||||||||||||||||||||||  ||   |.|
Sbjct: 54 INELSNVPVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKF 95

>hg18||uc002hqt
        |17|BC027459|P78356-2|P78356-2|PIP5K2B|NM_003559|NP_003550|phosphatidyl
        inositol-4-phosphate 5-kinase type

          Length = 289

 Score =  70 bits (171), Expect = 5e-013
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 2/42 (4%)

Query: 11 VNELSNVPVPVMLMPDDFKAYSKIKVDNHLFN--NLAVWFQF 50
          .|||||||||||||||||||||||||||||||  ||   |.|
Sbjct: 54 INELSNVPVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKF 95

>hg18||uc001irl
        |10|NM_005028|P48426|PI52A_HUMAN|PIP5K2A|NM_005028|NP_005019|phosphatid
        ylinositol-4-phosphate 5-kinase type

          Length = 406

 Score =  65 bits (156), Expect = 3e-011
 Identities = 31/42 (73%), Positives = 36/42 (85%), Gaps = 2/42 (4%)

Query: 11 VNELSNVPVPVMLMPDDFKAYSKIKVDNHLFN--NLAVWFQF 50
          .||||.| .|||||||||||||||||||||||  |.   |.|
Sbjct: 49 INELSHVQIPVMLMPDDFKAYSKIKVDNHLFNKENMPSHFKF 90

>hg18||uc001sot
        |12|NM_024779|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_024779|NP_079055|phosphati
        dylinositol-4-phosphate 5-kinase, type

          Length = 421

 Score =  63 bits (152), Expect = 8e-011
 Identities = 36/88 (40%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query:  49 QFLATLKIMDYSLLVGIHDVDRAX--XXXXXXXXXXXXXXXXXXXMGGGVLTGSFGTPPD 106
           .||  |||||||||.||||. |                        |   | ||.|| |.
Sbjct: 271 EFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPE 330

Query: 107 SPGNPLNCGGFFGPGEFDSSVDVYAIKS 134
             |  ..     |||||.| .|||||.|
Sbjct: 331 GIGGYIHSHRPLGPGEFESFIDVYAIRS 358

>hg18||uc001sou
        |12|AK075553|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_024779|NP_079055|phosphatid
        ylinositol-4-phosphate 5-kinase, type

          Length = 421

 Score =  63 bits (152), Expect = 8e-011
 Identities = 36/88 (40%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query:  49 QFLATLKIMDYSLLVGIHDVDRAX--XXXXXXXXXXXXXXXXXXXMGGGVLTGSFGTPPD 106
           .||  |||||||||.||||. |                        |   | ||.|| |.
Sbjct: 271 EFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPE 330

Query: 107 SPGNPLNCGGFFGPGEFDSSVDVYAIKS 134
             |  ..     |||||.| .|||||.|
Sbjct: 331 GIGGYIHSHRPLGPGEFESFIDVYAIRS 358

>hg18||uc001sot
        |12|NM_024779|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_024779|NP_079055|phosphati
        dylinositol-4-phosphate 5-kinase, type

          Length = 421

 Score =  58 bits (138), Expect = 3e-009
 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%)

Query:  11 VNELSNVPVPVMLMPDDFKAYSKIKVDNHLFN--NLAVWFQF 50
           .|||| || ||||.|||||| |||||.||||.  ||   |.|
Sbjct:  59 INELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKF 100

>hg18||uc001sou
        |12|AK075553|Q8TBX8|Q8TBX8_HUMAN|PIP5K2C|NM_024779|NP_079055|phosphatid
        ylinositol-4-phosphate 5-kinase, type

          Length = 421

 Score =  58 bits (138), Expect = 3e-009
 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%)

Query:  11 VNELSNVPVPVMLMPDDFKAYSKIKVDNHLFN--NLAVWFQF 50
           .|||| || ||||.|||||| |||||.||||.  ||   |.|
Sbjct:  59 INELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKF 100

>hg18||uc001exi
        |1|NM_003557|Q99755-3|Q99755-3|PIP5K1A|NM_003557|NP_003548|phosphatidyl
        inositol-4-phosphate 5-kinase, type

          Length = 549

 Score =  32 bits (72), Expect = 0.148
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query:  36 VDNHLFNNLAVWFQ----FLATLKIMDYSLLVGIHDVDRA 71
           .|  ..| |    |     | . ||||||||. ||..| |
Sbjct: 283 LDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHA 322

>hg18||uc001exj
        |1|U78576|Q99755|PI51A_HUMAN|PIP5K1A|NM_003557|NP_003548|phosphatidylin
        ositol-4-phosphate 5-kinase, type

          Length = 562

 Score =  32 bits (72), Expect = 0.148
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query:  36 VDNHLFNNLAVWFQ----FLATLKIMDYSLLVGIHDVDRA 71
           .|  ..| |    |     | . ||||||||. ||..| |
Sbjct: 296 LDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHA 335

>hg18||uc001exk
        |1|U78577|Q99755-2|Q99755-2|PIP5K1A|NM_003557|NP_003548|phosphatidylino
        sitol-4-phosphate 5-kinase, type

          Length = 500

 Score =  32 bits (72), Expect = 0.148
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query:  36 VDNHLFNNLAVWFQ----FLATLKIMDYSLLVGIHDVDRA 71
           .|  ..| |    |     | . ||||||||. ||..| |
Sbjct: 283 LDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHA 322

>hg18||uc002lyj
        |19|NM_012398|O60331|PI51C_HUMAN|PIP5K1C|NM_012398|NP_036530|phosphatid
        ylinositol-4-phosphate 5-kinase, type

          Length = 668

 Score =  32 bits (72), Expect = 0.148
 Identities = 12/20 (60%), Positives = 18/20 (90%)

Query:  51 LATLKIMDYSLLVGIHDVDR 70
           | . ||||||||.|.|..|.
Sbjct: 309 LESFKIMDYSLLLGVHNIDQ 328

>hg18||uc004agu
        |9|NM_003558|O14986|PI51B_HUMAN|PIP5K1B|NM_003558|NP_003549|phosphatidy
        linositol-4-phosphate 5-kinase, type

          Length = 540

 Score =  32 bits (70), Expect = 0.252
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query:  31 YSKIKVDNHLFNNLAVWFQFLATLKIMDYSLLVGIHDVDRA 71
           |   .  | |   |    . | . ||||||||.||| .| .
Sbjct: 239 YFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHS 279

>hg18||uc003cxf
        |3|NM_001640|P13798|ACPH_HUMAN|APEH|NM_001640|NP_001631|N-acylaminoacyl
        -peptide hydrolase

          Length = 732

 Score =  30 bits (66), Expect = 0.733
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query:  16 NVPVPVMLMPDDFKAYSKIKVDNHLFNNLAVWFQ 49
           |||| ..| |    | |...|..  | |  .| .
Sbjct: 694 NVPVRLLLYPKSTHALSEVEVESDSFMNAVLWLR 727

>hg18||uc003mxx |6|DQ577059|Q8TBY6|Q8TBY6_HUMAN|MGC26597|NA|NA|MGC26597 protein

          Length = 512

 Score =  29 bits (64), Expect = 1.251
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query:  51 LATLKIMDYSLLVGIHDVDRA 71
           | . ||||||| . ||..| |
Sbjct: 302 LQSFKIMDYSLWLSIHNIDHA 322

>hg18||uc002ibj |17|NM_032387|Q96J92|WNK4_HUMAN|WNK4|NM_032387|NP_115763|WNK
        lysine deficient protein kinase 4

          Length = 1243

 Score =  28 bits (60), Expect = 3.639
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 100 SFGTPPDSPGNPLNCGGFFGPGEFDSSVDVYAIKS 134
           .| |   ||| ||. |  | ||   |   .. | |
Sbjct: 799 AFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITS 833

>hg18||uc002ibk |17|AK096052|NA|NA|WNK4|NM_032387|NP_115763|WNK lysine deficient
        protein kinase 4

          Length = 759

 Score =  28 bits (60), Expect = 3.639
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 100 SFGTPPDSPGNPLNCGGFFGPGEFDSSVDVYAIKS 134
           .| |   ||| ||. |  | ||   |   .. | |
Sbjct: 571 AFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITS 605

>hg18||uc003fsk
        |3|NM_134470|Q9NPH3-2|Q9NPH3-2|IL1RAP|NM_134470|NP_608273|interleukin 1
        receptor accessory protein isoform

          Length = 356

 Score =  27 bits (58), Expect = 6.206
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query:   5 TLTVPLVNELSNVPVPVMLMPDDFKAYSKIKVDNHLFNNLAVWFQFL 51
           |||| .|    |   ||.  |.|   | | .    |     |.| ||
Sbjct: 228 TLTVKVVGSPKNAVPPVIHSPNDHVVYEK-EPGEELLIPCTVYFSFL 273

>hg18||uc003fsl
        |3|AF538732|Q9NPH3-2|Q9NPH3-2|IL1RAP|NM_134470|NP_608273|interleukin 1
        receptor accessory protein isoform

          Length = 356

 Score =  27 bits (58), Expect = 6.206
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query:   5 TLTVPLVNELSNVPVPVMLMPDDFKAYSKIKVDNHLFNNLAVWFQFL 51
           |||| .|    |   ||.  |.|   | | .    |     |.| ||
Sbjct: 228 TLTVKVVGSPKNAVPPVIHSPNDHVVYEK-EPGEELLIPCTVYFSFL 273

>hg18||uc003fsm
        |3|NM_002182|Q9NPH3|IL1AP_HUMAN|IL1RAP|NM_002182|NP_002173|interleukin
        1 receptor accessory protein isoform

          Length = 570

 Score =  27 bits (58), Expect = 6.206
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query:   5 TLTVPLVNELSNVPVPVMLMPDDFKAYSKIKVDNHLFNNLAVWFQFL 51
           |||| .|    |   ||.  |.|   | | .    |     |.| ||
Sbjct: 228 TLTVKVVGSPKNAVPPVIHSPNDHVVYEK-EPGEELLIPCTVYFSFL 273

>hg18||uc003fso
        |3|AF538733|Q9NPH3|IL1AP_HUMAN|IL1RAP|NM_002182|NP_002173|interleukin 1
        receptor accessory protein isoform

          Length = 570

 Score =  27 bits (58), Expect = 6.206
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query:   5 TLTVPLVNELSNVPVPVMLMPDDFKAYSKIKVDNHLFNNLAVWFQFL 51
           |||| .|    |   ||.  |.|   | | .    |     |.| ||
Sbjct: 228 TLTVKVVGSPKNAVPPVIHSPNDHVVYEK-EPGEELLIPCTVYFSFL 273

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0