BLASTP 7.6.0


Query=fugu4_747050 |jgi|Takru4|747050|fgh5_pg.C_scaffold_4734000001
        (305 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001hwv |1|NM_001037277|O95749|GGPPS_HUMAN|GGPS1|NM_00103...    421   9e-118
hg18||uc001hww |1|NM_004837|O95749|GGPPS_HUMAN|GGPS1|NM_004837|N...    421   9e-118
hg18||uc001hwy |1|CR603114|O95749|GGPPS_HUMAN|GGPS1|NM_004837|NP...    421   9e-118
hg18||uc001hwx |1|NM_001037278|O95749|GGPPS_HUMAN|GGPS1|NM_00103...    408   5e-114
hg18||uc002nus |19|CR622600|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|N...     29   7.430
hg18||uc002nut |19|AB047801|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|N...     29   7.430
hg18||uc002nuu |19|NM_022467|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|...     29   7.430
hg18||uc004abi |9|NM_033655|Q5VYQ4|Q5VYQ4_HUMAN|CNTNAP3|NM_03365...     28   9.704
hg18||uc004abj |9|BC132737|Q5VYQ4|Q5VYQ4_HUMAN|CNTNAP3|NM_033655...     28   9.704
hg18||uc004abk |9|AB051501|Q5VYQ7|Q5VYQ7_HUMAN|CNTNAP3|NA|NA|Con...     28   9.704
hg18||uc004abl |9|CR614145|Q5VYQ5|Q5VYQ5_HUMAN|CNTNAP3|NM_033655...     28   9.704

>hg18||uc001hwv
        |1|NM_001037277|O95749|GGPPS_HUMAN|GGPS1|NM_001037277|NP_001032354|gera
        nylgeranyl diphosphate synthase 1 isoform A

          Length = 300

 Score =  421 bits (1080), Expect = 9e-118
 Identities = 202/245 (82%), Positives = 227/245 (92%)

Query:  39 QVIIQVTEMLHNASLLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEKVLTL 98
           |.||.|||||||||||||||||.|||||||||||||||.|||||||||||||||||||||
Sbjct:  47 QIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTL 106

Query:  99 DHPEAVRVFTRQLLELHRGQGLDIHWRDTYTCPTEQEYRNMVLQKTGGLFGLAVGLMQLF 158
           |||.||..|||||||||.||||||.||| ||||||.||. ||||||||||||||||||||
Sbjct: 107 DHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLF 166

Query: 159 SDWKQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSFPIIHAIWSRPE 218
           ||.|.||||.|.|||||||| ||||||.|.||  |||.|||||||||||| |||||||||
Sbjct: 167 SDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPE 226

Query: 219 STQVQNILRQRTENTDIKRYCVDYLEKVGSFAYTRQTLHDLEAESYRLIREFGGNPQLES 278
           |||||||||||||| |||.||| ||| |||| ||| || .|||..|. |   ||||.| .
Sbjct: 227 STQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVA 286

Query: 279 LVKQL 283
           ||| |
Sbjct: 287 LVKHL 291

>hg18||uc001hww
        |1|NM_004837|O95749|GGPPS_HUMAN|GGPS1|NM_004837|NP_004828|geranylgerany
        l diphosphate synthase 1 isoform A

          Length = 300

 Score =  421 bits (1080), Expect = 9e-118
 Identities = 202/245 (82%), Positives = 227/245 (92%)

Query:  39 QVIIQVTEMLHNASLLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEKVLTL 98
           |.||.|||||||||||||||||.|||||||||||||||.|||||||||||||||||||||
Sbjct:  47 QIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTL 106

Query:  99 DHPEAVRVFTRQLLELHRGQGLDIHWRDTYTCPTEQEYRNMVLQKTGGLFGLAVGLMQLF 158
           |||.||..|||||||||.||||||.||| ||||||.||. ||||||||||||||||||||
Sbjct: 107 DHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLF 166

Query: 159 SDWKQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSFPIIHAIWSRPE 218
           ||.|.||||.|.|||||||| ||||||.|.||  |||.|||||||||||| |||||||||
Sbjct: 167 SDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPE 226

Query: 219 STQVQNILRQRTENTDIKRYCVDYLEKVGSFAYTRQTLHDLEAESYRLIREFGGNPQLES 278
           |||||||||||||| |||.||| ||| |||| ||| || .|||..|. |   ||||.| .
Sbjct: 227 STQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVA 286

Query: 279 LVKQL 283
           ||| |
Sbjct: 287 LVKHL 291

>hg18||uc001hwy
        |1|CR603114|O95749|GGPPS_HUMAN|GGPS1|NM_004837|NP_004828|geranylgeranyl
        diphosphate synthase 1 isoform A

          Length = 300

 Score =  421 bits (1080), Expect = 9e-118
 Identities = 202/245 (82%), Positives = 227/245 (92%)

Query:  39 QVIIQVTEMLHNASLLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEKVLTL 98
           |.||.|||||||||||||||||.|||||||||||||||.|||||||||||||||||||||
Sbjct:  47 QIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTL 106

Query:  99 DHPEAVRVFTRQLLELHRGQGLDIHWRDTYTCPTEQEYRNMVLQKTGGLFGLAVGLMQLF 158
           |||.||..|||||||||.||||||.||| ||||||.||. ||||||||||||||||||||
Sbjct: 107 DHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLF 166

Query: 159 SDWKQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSFPIIHAIWSRPE 218
           ||.|.||||.|.|||||||| ||||||.|.||  |||.|||||||||||| |||||||||
Sbjct: 167 SDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPE 226

Query: 219 STQVQNILRQRTENTDIKRYCVDYLEKVGSFAYTRQTLHDLEAESYRLIREFGGNPQLES 278
           |||||||||||||| |||.||| ||| |||| ||| || .|||..|. |   ||||.| .
Sbjct: 227 STQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVA 286

Query: 279 LVKQL 283
           ||| |
Sbjct: 287 LVKHL 291

>hg18||uc001hwx
        |1|NM_001037278|O95749|GGPPS_HUMAN|GGPS1|NM_001037278|NP_001032355|gera
        nylgeranyl diphosphate synthase 1 isoform B

          Length = 246

 Score =  408 bits (1048), Expect = 5e-114
 Identities = 196/237 (82%), Positives = 219/237 (92%)

Query:  47 MLHNASLLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEKVLTLDHPEAVRV 106
           ||||||||||||||.|||||||||||||||.||||||||||||||||||||||||.||..
Sbjct:   1 MLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKL 60

Query: 107 FTRQLLELHRGQGLDIHWRDTYTCPTEQEYRNMVLQKTGGLFGLAVGLMQLFSDWKQDLK 166
           |||||||||.||||||.||| ||||||.||. ||||||||||||||||||||||.|.|||
Sbjct:  61 FTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLK 120

Query: 167 PILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSFPIIHAIWSRPESTQVQNIL 226
           |.|.|||||||| ||||||.|.||  |||.|||||||||||| |||||||||||||||||
Sbjct: 121 PLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNIL 180

Query: 227 RQRTENTDIKRYCVDYLEKVGSFAYTRQTLHDLEAESYRLIREFGGNPQLESLVKQL 283
           |||||| |||.||| ||| |||| ||| || .|||..|. |   ||||.| .||| |
Sbjct: 181 RQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHL 237

>hg18||uc002nus
        |19|CR622600|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|NP_071912|carbohydrate
        (N-acetylgalactosamine 4-0)

          Length = 417

 Score =  29 bits (63), Expect = 7.430
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 107 FTRQLLELHRGQGLDIHW 124
           | . ||..||  |.||||
Sbjct: 304 FVQYLLDVHRPVGMDIHW 321

>hg18||uc002nut
        |19|AB047801|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|NP_071912|carbohydrate
        (N-acetylgalactosamine 4-0)

          Length = 417

 Score =  29 bits (63), Expect = 7.430
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 107 FTRQLLELHRGQGLDIHW 124
           | . ||..||  |.||||
Sbjct: 304 FVQYLLDVHRPVGMDIHW 321

>hg18||uc002nuu
        |19|NM_022467|Q9H2A9|CHST8_HUMAN|CHST8|NM_022467|NP_071912|carbohydrate
        (N-acetylgalactosamine 4-0)

          Length = 424

 Score =  29 bits (63), Expect = 7.430
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 107 FTRQLLELHRGQGLDIHW 124
           | . ||..||  |.||||
Sbjct: 311 FVQYLLDVHRPVGMDIHW 328

>hg18||uc004abi
        |9|NM_033655|Q5VYQ4|Q5VYQ4_HUMAN|CNTNAP3|NM_033655|NP_387504|cell
        recognition molecule CASPR3

          Length = 1288

 Score =  28 bits (62), Expect = 9.704
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 162 KQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSF 207
           |. |||| | . | |. .     |  ||  |      .| .||  |
Sbjct: 198 KKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGKLVF 243

>hg18||uc004abj |9|BC132737|Q5VYQ4|Q5VYQ4_HUMAN|CNTNAP3|NM_033655|NP_387504|cell
        recognition molecule CASPR3

          Length = 1207

 Score =  28 bits (62), Expect = 9.704
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 162 KQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSF 207
           |. |||| | . | |. .     |  ||  |      .| .||  |
Sbjct: 198 KKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGKLVF 243

>hg18||uc004abk |9|AB051501|Q5VYQ7|Q5VYQ7_HUMAN|CNTNAP3|NA|NA|Contactin
        associated protein-like 3

          Length = 1127

 Score =  28 bits (62), Expect = 9.704
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 162 KQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSF 207
           |. |||| | . | |. .     |  ||  |      .| .||  |
Sbjct: 198 KKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGKLVF 243

>hg18||uc004abl |9|CR614145|Q5VYQ5|Q5VYQ5_HUMAN|CNTNAP3|NM_033655|NP_387504|cell
        recognition molecule CASPR3

          Length = 517

 Score =  28 bits (62), Expect = 9.704
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 162 KQDLKPILDTLGLFFQILDDYANLNSREYCHNKSYCEDLTEGKFSF 207
           |. |||| | . | |. .     |  ||  |      .| .||  |
Sbjct: 110 KKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGKLVF 155

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,290,635
Number of Sequences: 45480
Number of Extensions: 191290635
Number of Successful Extensions: 11080124
Number of sequences better than 0.0: 0
BLASTP 7.6.0