BLASTP 7.6.0


Query=fugu4_747041 |jgi|Takru4|747041|fgh5_pg.C_scaffold_4713000001
        (213 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001yus |15|NM_014608|Q14467|Q14467_HUMAN|CYFIP1|NM_01460...     28   5.510
hg18||uc001yut |15|AY763578|Q7L576|Q7L576_HUMAN|CYFIP1|NM_014608...     28   5.510

>hg18||uc001yus
        |15|NM_014608|Q14467|Q14467_HUMAN|CYFIP1|NM_014608|NP_055423|cytoplasmi
        c FMR1 interacting protein 1 isoform

          Length = 1253

 Score =  28 bits (62), Expect = 5.510
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query:  20 LKEIFNRRWDEQQWSRYLEEKNLCGRTPVQSFIDANENQVREVCRASGKRVVNANDPAND 79
           .. .||       ..   .   .  | |..  |   .| .. | .|  | | .      .
Sbjct: 468 MESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDW-----E 522

Query:  80 PAHDPANDPAHDPANDP 96
             |.| ||||     ||
Sbjct: 523 TGHEPFNDPALRGEKDP 539

>hg18||uc001yut
        |15|AY763578|Q7L576|Q7L576_HUMAN|CYFIP1|NM_014608|NP_055423|cytoplasmic
        FMR1 interacting protein 1 isoform

          Length = 1253

 Score =  28 bits (62), Expect = 5.510
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query:  20 LKEIFNRRWDEQQWSRYLEEKNLCGRTPVQSFIDANENQVREVCRASGKRVVNANDPAND 79
           .. .||       ..   .   .  | |..  |   .| .. | .|  | | .      .
Sbjct: 468 MESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDW-----E 522

Query:  80 PAHDPANDPAHDPANDP 96
             |.| ||||     ||
Sbjct: 523 TGHEPFNDPALRGEKDP 539

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0