BLASTP 7.6.0


Query=fugu4_747034 |jgi|Takru4|747034|fgh5_pg.C_scaffold_4697000002
        (140 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001kfk |10|NM_020799|Q96FJ0|STALP_HUMAN|STAMBPL1|NM_0207...    186   7e-048
hg18||uc001kfl |10|AK092946|Q96FJ0|STALP_HUMAN|STAMBPL1|NM_02079...    186   7e-048
hg18||uc002sjs |2|NM_201647|O95630|STABP_HUMAN|STAMBP|NM_201647|...    141   4e-034
hg18||uc002sjt |2|CR596067|O95630|STABP_HUMAN|STAMBP|NM_213622|N...    141   4e-034
hg18||uc002sju |2|NM_006463|O95630|STABP_HUMAN|STAMBP|NM_006463|...    141   4e-034
hg18||uc002sjv |2|NM_213622|O95630|STABP_HUMAN|STAMBP|NM_213622|...    141   4e-034
hg18||uc003jft |5|NM_012334|O94893|O94893_HUMAN|MYO10|NM_012334|...     31   0.360
hg18||uc001zyl |15|NM_005154|Q2TB31|Q2TB31_HUMAN|USP8|NM_005154|...     28   2.332
hg18||uc001zym |15|BC015545|NA|NA|USP8|NM_005154|NP_005145|ubiqu...     28   2.332
hg18||uc001zyn |15|D29956|P40818|UBP8_HUMAN|USP8|NM_005154|NP_00...     28   2.332
hg18||uc001nzb |11|NM_000932|Q01970|PLCB3_HUMAN|PLCB3|NM_000932|...     27   6.784

>hg18||uc001kfk
        |10|NM_020799|Q96FJ0|STALP_HUMAN|STAMBPL1|NM_020799|NP_065850|associate
        d molecule with the SH3 domain of STAM

          Length = 436

 Score =  186 bits (472), Expect = 7e-048
 Identities = 90/140 (64%), Positives = 116/140 (82%)

Query:   1 MEEGFSLNVLKKVAAEADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMER 60
           |.. |..| |||.||  |.|||||.  |||||| |.| .. |..|. |||||||||||||
Sbjct:   1 MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER 60

Query:  61 MADVYLAEGSLENAYVLYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDD 120
           || ||| ||.||||.||| ||| |||||||.|||||||.|||.. |||||.|.  || |.
Sbjct:  61 MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE 120

Query: 121 LKKRLEEKYSRDQREYLSSK 140
           ||  | .||. . .||| ||
Sbjct: 121 LKNDLLKKYNVEYQEYLQSK 140

>hg18||uc001kfl
        |10|AK092946|Q96FJ0|STALP_HUMAN|STAMBPL1|NM_020799|NP_065850|associated
        molecule with the SH3 domain of STAM

          Length = 436

 Score =  186 bits (472), Expect = 7e-048
 Identities = 90/140 (64%), Positives = 116/140 (82%)

Query:   1 MEEGFSLNVLKKVAAEADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMER 60
           |.. |..| |||.||  |.|||||.  |||||| |.| .. |..|. |||||||||||||
Sbjct:   1 MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER 60

Query:  61 MADVYLAEGSLENAYVLYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDD 120
           || ||| ||.||||.||| ||| |||||||.|||||||.|||.. |||||.|.  || |.
Sbjct:  61 MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE 120

Query: 121 LKKRLEEKYSRDQREYLSSK 140
           ||  | .||. . .||| ||
Sbjct: 121 LKNDLLKKYNVEYQEYLQSK 140

>hg18||uc002sjs |2|NM_201647|O95630|STABP_HUMAN|STAMBP|NM_201647|NP_964010|STAM
        binding protein

          Length = 424

 Score =  141 bits (353), Expect = 4e-034
 Identities = 61/124 (49%), Positives = 95/124 (76%)

Query:  17 ADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMERMADVYLAEGSLENAYV 76
           .|. ||||   .||||| ..|..||.|.|. ||||||||||. ||| .|  ||..|.|..
Sbjct:   2 SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFI 61

Query:  77 LYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQREY 136
           || |.| ||.|||| ||||.   .||..  .|||.|.  |. ..||  | ..|...  ||
Sbjct:  62 LYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEY 121

Query: 137 LSSK 140
              |
Sbjct: 122 NEEK 125

>hg18||uc002sjt |2|CR596067|O95630|STABP_HUMAN|STAMBP|NM_213622|NP_998787|STAM
        binding protein

          Length = 424

 Score =  141 bits (353), Expect = 4e-034
 Identities = 61/124 (49%), Positives = 95/124 (76%)

Query:  17 ADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMERMADVYLAEGSLENAYV 76
           .|. ||||   .||||| ..|..||.|.|. ||||||||||. ||| .|  ||..|.|..
Sbjct:   2 SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFI 61

Query:  77 LYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQREY 136
           || |.| ||.|||| ||||.   .||..  .|||.|.  |. ..||  | ..|...  ||
Sbjct:  62 LYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEY 121

Query: 137 LSSK 140
              |
Sbjct: 122 NEEK 125

>hg18||uc002sju |2|NM_006463|O95630|STABP_HUMAN|STAMBP|NM_006463|NP_006454|STAM
        binding protein

          Length = 424

 Score =  141 bits (353), Expect = 4e-034
 Identities = 61/124 (49%), Positives = 95/124 (76%)

Query:  17 ADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMERMADVYLAEGSLENAYV 76
           .|. ||||   .||||| ..|..||.|.|. ||||||||||. ||| .|  ||..|.|..
Sbjct:   2 SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFI 61

Query:  77 LYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQREY 136
           || |.| ||.|||| ||||.   .||..  .|||.|.  |. ..||  | ..|...  ||
Sbjct:  62 LYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEY 121

Query: 137 LSSK 140
              |
Sbjct: 122 NEEK 125

>hg18||uc002sjv |2|NM_213622|O95630|STABP_HUMAN|STAMBP|NM_213622|NP_998787|STAM
        binding protein

          Length = 424

 Score =  141 bits (353), Expect = 4e-034
 Identities = 61/124 (49%), Positives = 95/124 (76%)

Query:  17 ADYTDVSLTAAERVRALGKMGNSVEINQDVHPRRYFRSGVEMERMADVYLAEGSLENAYV 76
           .|. ||||   .||||| ..|..||.|.|. ||||||||||. ||| .|  ||..|.|..
Sbjct:   2 SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFI 61

Query:  77 LYTKFIILFVEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQREY 136
           || |.| ||.|||| ||||.   .||..  .|||.|.  |. ..||  | ..|...  ||
Sbjct:  62 LYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEY 121

Query: 137 LSSK 140
              |
Sbjct: 122 NEEK 125

>hg18||uc003jft
        |5|NM_012334|O94893|O94893_HUMAN|MYO10|NM_012334|NP_036466|myosin X

          Length = 2058

 Score =  31 bits (69), Expect = 0.360
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query:  86 VEKLPHHRDYQQCSVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQREYLSS 139
           .| |   .. |. |. |  |  .||||    |||   .||||.  |  .|.| |
Sbjct: 897 IEDLQRMKEQQELSLTEASL--QKLQE----RRDQELRRLEEEACRAAQEFLES 944

>hg18||uc001zyl
        |15|NM_005154|Q2TB31|Q2TB31_HUMAN|USP8|NM_005154|NP_005145|ubiquitin
        specific protease 8

          Length = 1118

 Score =  28 bits (62), Expect = 2.332
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query:  44 QDVHPRRYFRSGVEMERMADVYLAEGSLENAYVLYTKFIILF--VEKLP---HHRDYQQC 98
           . .  . |  | ... . |.    .   | ||||| |.. ..  ..| |     .||   
Sbjct:  29 EKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHS 88

Query:  99 SVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQRE 135
            .    .  ||  |      . || | ||   | . |
Sbjct:  89 ILGPGNI--KKAVEEAERLSESLKLRYEEAEVRKKLE 123

>hg18||uc001zym |15|BC015545|NA|NA|USP8|NM_005154|NP_005145|ubiquitin specific
        protease 8

          Length = 601

 Score =  28 bits (62), Expect = 2.332
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query:  44 QDVHPRRYFRSGVEMERMADVYLAEGSLENAYVLYTKFIILF--VEKLP---HHRDYQQC 98
           . .  . |  | ... . |.    .   | ||||| |.. ..  ..| |     .||   
Sbjct:  29 EKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHS 88

Query:  99 SVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQRE 135
            .    .  ||  |      . || | ||   | . |
Sbjct:  89 ILGPGNI--KKAVEEAERLSESLKLRYEEAEVRKKLE 123

>hg18||uc001zyn |15|D29956|P40818|UBP8_HUMAN|USP8|NM_005154|NP_005145|ubiquitin
        specific protease 8

          Length = 1118

 Score =  28 bits (62), Expect = 2.332
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query:  44 QDVHPRRYFRSGVEMERMADVYLAEGSLENAYVLYTKFIILF--VEKLP---HHRDYQQC 98
           . .  . |  | ... . |.    .   | ||||| |.. ..  ..| |     .||   
Sbjct:  29 EKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHS 88

Query:  99 SVPERRLIMKKLQEVVLPRRDDLKKRLEEKYSRDQRE 135
            .    .  ||  |      . || | ||   | . |
Sbjct:  89 ILGPGNI--KKAVEEAERLSESLKLRYEEAEVRKKLE 123

>hg18||uc001nzb
        |11|NM_000932|Q01970|PLCB3_HUMAN|PLCB3|NM_000932|NP_000923|phospholipas
        e C, beta 3

          Length = 1234

 Score =  27 bits (58), Expect = 6.784
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query:   78 YTKFIILFVEKLPHHRDYQQCSVPERRL-----IMKKLQEVVLPRRDDLKKRLEEKYSRD 132
            | .|    |. |   |. |  .  .|||      ...|.||||       |||.|   |.
Sbjct: 1031 YQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNERE 1090

Query:  133 QRE 135
            ..|
Sbjct: 1091 KKE 1093

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,157,128
Number of Sequences: 45480
Number of Extensions: 189157128
Number of Successful Extensions: 11266464
Number of sequences better than 0.0: 0
BLASTP 7.6.0