BLASTP 7.6.0


Query=fugu4_747007 |jgi|Takru4|747007|fgh5_pg.C_scaffold_4643000001
        (238 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003kbw |5|NM_005909|P46821|MAP1B_HUMAN|MAP1B|NM_005909|N...     55   5e-008
hg18||uc003kbx |5|NM_032010|P46821|MAP1B_HUMAN|MAP1B|NM_032010|N...     55   5e-008
hg18||uc003ule |7|NM_147166|NA|NA|AKAP9|NM_147166|NP_671695|A-ki...     51   1e-006
hg18||uc003ulf |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP...     51   1e-006
hg18||uc003ulg |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP...     51   1e-006
hg18||uc003ulh |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|N...     51   1e-006
hg18||uc002kte |18|NM_005406|Q13464|ROCK1_HUMAN|ROCK1|NM_005406|...     50   2e-006
hg18||uc002kte |18|NM_005406|Q13464|ROCK1_HUMAN|ROCK1|NM_005406|...     48   8e-006
hg18||uc003ule |7|NM_147166|NA|NA|AKAP9|NM_147166|NP_671695|A-ki...     46   3e-005
hg18||uc003ulf |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP...     46   3e-005
hg18||uc003ulg |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP...     46   3e-005
hg18||uc003ulh |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|N...     46   3e-005
hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP...     40   0.002
hg18||uc002hvi |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|...     40   0.002
hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_...     40   0.003
hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_0...     40   0.003
hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_8...     40   0.003
hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_8...     40   0.003
hg18||uc003zqg |9|NM_025103|A0PJM7|A0PJM7_HUMAN|IFT74|NM_025103|...     40   0.003
hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP...     39   0.006
hg18||uc002xsr |20|AK001175|NA|NA|ZMYND8|NM_183048|NP_898869|zin...     39   0.006
hg18||uc002xss |20|DQ368674|Q2HXV7|Q2HXV7_HUMAN|ZMYND8|NM_183048...     39   0.006
hg18||uc002xst |20|DQ368677|Q2HXV4|Q2HXV4_HUMAN|ZMYND8|NM_183048...     39   0.006
hg18||uc002xsu |20|DQ082999|Q9ULU4-8|Q9ULU4-8|ZMYND8|NM_183047|N...     39   0.006
hg18||uc002xsv |20|DQ368680|Q2HXV1|Q2HXV1_HUMAN|ZMYND8|NM_183048...     39   0.006
hg18||uc002xsw |20|DQ368675|NA|NA|KIAA1125|NA|NA|Homo sapiens mR...     39   0.006
hg18||uc002xsx |20|DQ368676|NA|NA|KIAA1125|NA|NA|Homo sapiens mR...     39   0.006
hg18||uc002xsy |20|DQ368672|Q2HXV9|Q2HXV9_HUMAN|ZMYND8|NM_183047...     39   0.006
hg18||uc002xsz |20|AK122966|Q9ULU4-6|Q9ULU4-6|ZMYND8|NM_183047|N...     39   0.006
hg18||uc002xta |20|AB032951|Q9ULU4|PKCB1_HUMAN|ZMYND8|NM_012408|...     39   0.006
hg18||uc002xtb |20|NM_183047|Q2HXW2|Q2HXW2_HUMAN|ZMYND8|NM_18304...     39   0.006
hg18||uc002xtc |20|NM_012408|Q2HXW1|Q2HXW1_HUMAN|ZMYND8|NM_01240...     39   0.006
hg18||uc002xtd |20|NM_183048|Q2HXW0|Q2HXW0_HUMAN|ZMYND8|NM_18304...     39   0.006
hg18||uc002xte |20|BX641005|Q9ULU4-9|Q9ULU4-9|PRKCBP1|NA|NA|Prot...     39   0.006
hg18||uc002xtf |20|AK225857|Q2HXV8|Q2HXV8_HUMAN|ZMYND8|NM_183047...     39   0.006
hg18||uc003wla |7|NM_170606|Q8NEZ4|MLL3_HUMAN|MLL3|NM_170606|NP_...     39   0.006
hg18||uc002hvi |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|...     38   0.008
hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_...     37   0.014
hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_...     37   0.024
hg18||uc002xsr |20|AK001175|NA|NA|ZMYND8|NM_183048|NP_898869|zin...     36   0.032
hg18||uc002xss |20|DQ368674|Q2HXV7|Q2HXV7_HUMAN|ZMYND8|NM_183048...     36   0.032
hg18||uc002xst |20|DQ368677|Q2HXV4|Q2HXV4_HUMAN|ZMYND8|NM_183048...     36   0.032
hg18||uc002xsu |20|DQ082999|Q9ULU4-8|Q9ULU4-8|ZMYND8|NM_183047|N...     36   0.032
hg18||uc002xsv |20|DQ368680|Q2HXV1|Q2HXV1_HUMAN|ZMYND8|NM_183048...     36   0.032
hg18||uc002xsw |20|DQ368675|NA|NA|KIAA1125|NA|NA|Homo sapiens mR...     36   0.032
hg18||uc002xsx |20|DQ368676|NA|NA|KIAA1125|NA|NA|Homo sapiens mR...     36   0.032
hg18||uc002xsy |20|DQ368672|Q2HXV9|Q2HXV9_HUMAN|ZMYND8|NM_183047...     36   0.032
hg18||uc002xsz |20|AK122966|Q9ULU4-6|Q9ULU4-6|ZMYND8|NM_183047|N...     36   0.032
hg18||uc002xta |20|AB032951|Q9ULU4|PKCB1_HUMAN|ZMYND8|NM_012408|...     36   0.032
hg18||uc002xtb |20|NM_183047|Q2HXW2|Q2HXW2_HUMAN|ZMYND8|NM_18304...     36   0.032
hg18||uc002xtc |20|NM_012408|Q2HXW1|Q2HXW1_HUMAN|ZMYND8|NM_01240...     36   0.032
hg18||uc002xtd |20|NM_183048|Q2HXW0|Q2HXW0_HUMAN|ZMYND8|NM_18304...     36   0.032
hg18||uc002xte |20|BX641005|Q9ULU4-9|Q9ULU4-9|PRKCBP1|NA|NA|Prot...     36   0.032
hg18||uc002xtf |20|AK225857|Q2HXV8|Q2HXV8_HUMAN|ZMYND8|NM_183047...     36   0.032
hg18||uc003ule |7|NM_147166|NA|NA|AKAP9|NM_147166|NP_671695|A-ki...     36   0.042
hg18||uc003ulf |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP...     36   0.042
hg18||uc003ulg |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP...     36   0.042
hg18||uc003ulh |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|N...     36   0.042
hg18||uc003zqf |9|BC107742|Q3B789|Q3B789_HUMAN|IFT74|NA|NA|IFT74...     35   0.055
hg18||uc002hvi |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|...     34   0.121
hg18||uc003qcg |6|CR749262|Q68DV2|Q68DV2_HUMAN|EPB41L2|NM_001431...     34   0.121
hg18||uc003qch |6|NM_001431|O43491|E41L2_HUMAN|EPB41L2|NM_001431...     34   0.121
hg18||uc003qci |6|BC034718|Q5T4F0|Q5T4F0_HUMAN|EPB41L2|NM_001431...     34   0.121
hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_...     34   0.121
hg18||uc003xed |8|NM_005382|P07197|NFM_HUMAN|NEFM|NM_005382|NP_0...     34   0.121
hg18||uc003zqg |9|NM_025103|A0PJM7|A0PJM7_HUMAN|IFT74|NM_025103|...     34   0.159
hg18||uc002hwu |17|NM_153490|P13646|K1C13_HUMAN|KRT13|NM_153490|...     33   0.207
hg18||uc003qcg |6|CR749262|Q68DV2|Q68DV2_HUMAN|EPB41L2|NM_001431...     33   0.207
hg18||uc003qch |6|NM_001431|O43491|E41L2_HUMAN|EPB41L2|NM_001431...     33   0.207
hg18||uc003qci |6|BC034718|Q5T4F0|Q5T4F0_HUMAN|EPB41L2|NM_001431...     33   0.207
hg18||uc003zqf |9|BC107742|Q3B789|Q3B789_HUMAN|IFT74|NA|NA|IFT74...     33   0.207
hg18||uc002hwv |17|NM_002274|NA|NA|KRT13|NM_002274|NP_002265|ker...     33   0.271
hg18||uc002hww |17|CR591347|NA|NA|KRT13|NA|NA|Homo sapiens cDNA ...     33   0.271
hg18||uc002hwx |17|AX747448|A1A4E9|A1A4E9_HUMAN|KRT13|NM_002274|...     33   0.271
hg18||uc002hvi |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|...     32   0.603
hg18||uc003xed |8|NM_005382|P07197|NFM_HUMAN|NEFM|NM_005382|NP_0...     32   0.787
hg18||uc001atn |1|NM_014874|O95140|MFN2_HUMAN|MFN2|NM_014874|NP_...     31   1.028
hg18||uc002hww |17|CR591347|NA|NA|KRT13|NA|NA|Homo sapiens cDNA ...     31   1.028
hg18||uc002hwx |17|AX747448|A1A4E9|A1A4E9_HUMAN|KRT13|NM_002274|...     31   1.028
hg18||uc003qcg |6|CR749262|Q68DV2|Q68DV2_HUMAN|EPB41L2|NM_001431...     31   1.028
hg18||uc003qch |6|NM_001431|O43491|E41L2_HUMAN|EPB41L2|NM_001431...     31   1.028
hg18||uc003qci |6|BC034718|Q5T4F0|Q5T4F0_HUMAN|EPB41L2|NM_001431...     31   1.028
hg18||uc002hwu |17|NM_153490|P13646|K1C13_HUMAN|KRT13|NM_153490|...     31   1.343
hg18||uc002hwv |17|NM_002274|NA|NA|KRT13|NM_002274|NP_002265|ker...     31   1.343
hg18||uc002tof |2|AK091500|NA|NA|ERCC3|NA|NA|Homo sapiens cDNA F...     30   2.290
hg18||uc002tog |2|AK095557|NA|NA|ERCC3|NA|NA|Homo sapiens cDNA F...     30   2.290
hg18||uc002toh |2|NM_000122|P19447|ERCC3_HUMAN|ERCC3|NM_000122|N...     30   2.290
hg18||uc003wla |7|NM_170606|Q8NEZ4|MLL3_HUMAN|MLL3|NM_170606|NP_...     30   2.290
hg18||uc003qcg |6|CR749262|Q68DV2|Q68DV2_HUMAN|EPB41L2|NM_001431...     29   5.102
hg18||uc003qch |6|NM_001431|O43491|E41L2_HUMAN|EPB41L2|NM_001431...     29   5.102
hg18||uc003qci |6|BC034718|Q5T4F0|Q5T4F0_HUMAN|EPB41L2|NM_001431...     29   5.102
hg18||uc002ihc |17|NM_144609|Q96MW1|CCD43_HUMAN|CCDC43|NM_144609...     28   8.703

>hg18||uc003kbw
        |5|NM_005909|P46821|MAP1B_HUMAN|MAP1B|NM_005909|NP_005900|microtubule-a
        ssociated protein 1B isoform 1

          Length = 2468

 Score =  55 bits (132), Expect = 5e-008
 Identities = 52/198 (26%), Positives = 97/198 (48%), Gaps = 14/198 (7%)

Query:   2 KQITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEM 61
           | . .| |.| | |. ..    |       ... |.  . .  | |    | .     | 
Sbjct: 555 KSVRKESKEE-TPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEP 613

Query:  62 KQITVEVKQEITVEMKQITVE---VKQEITVEMKQITEEM-KQEITVEMKQITVEVKKEI 117
             .  || ..   ..|    .   ||.|  |. .   ||  | .  |  |.    .||| 
Sbjct: 614 SPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEE 673

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEM--KQITEEMKKEITVEMKQITVEVKK 175
             . ... .|.|.||  | |   .| |.|.  |   |.. .|.|||   |.|.   | ||
Sbjct: 674 KPKKEEVKKEVKKEIKKEEK---KEPKKEVKKETPPKEVKKEVKKEEKKEVKKEEKEPKK 730

Query: 176 EITVEMKQITVEVKQEIT 193
           ||    |..  . |.  |
Sbjct: 731 EI----KKLPKDAKKSST 744

>hg18||uc003kbx
        |5|NM_032010|P46821|MAP1B_HUMAN|MAP1B|NM_032010|NP_114399|microtubule-a
        ssociated protein 1B isoform 2

          Length = 2342

 Score =  55 bits (132), Expect = 5e-008
 Identities = 52/198 (26%), Positives = 97/198 (48%), Gaps = 14/198 (7%)

Query:   2 KQITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEM 61
           | . .| |.| | |. ..    |       ... |.  . .  | |    | .     | 
Sbjct: 429 KSVRKESKEE-TPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEP 487

Query:  62 KQITVEVKQEITVEMKQITVE---VKQEITVEMKQITEEM-KQEITVEMKQITVEVKKEI 117
             .  || ..   ..|    .   ||.|  |. .   ||  | .  |  |.    .||| 
Sbjct: 488 SPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEE 547

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEM--KQITEEMKKEITVEMKQITVEVKK 175
             . ... .|.|.||  | |   .| |.|.  |   |.. .|.|||   |.|.   | ||
Sbjct: 548 KPKKEEVKKEVKKEIKKEEK---KEPKKEVKKETPPKEVKKEVKKEEKKEVKKEEKEPKK 604

Query: 176 EITVEMKQITVEVKQEIT 193
           ||    |..  . |.  |
Sbjct: 605 EI----KKLPKDAKKSST 618

>hg18||uc003ule |7|NM_147166|NA|NA|AKAP9|NM_147166|NP_671695|A-kinase anchor
        protein 9 isoform 4

          Length = 1655

 Score =  51 bits (120), Expect = 1e-006
 Identities = 48/208 (23%), Positives = 110/208 (52%), Gaps = 18/208 (8%)

Query:   4 ITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQ 63
           | ||.  .|  | |. |.|.| ..|   | .  |....| |.  |  . || |.|   ..
Sbjct: 342 IIEELNTKIIEEEKK-TLELKDKLTTADK-LLGELQEQI-VQKNQEIKNMKLELTNSKQK 398

Query:  64 ITVEVKQEITVEMKQI--TVEVKQEITVEMKQ----ITEEMKQEITVEMKQITVEVKKEI 117
                ... . |.||.  |||  |.   .  |    | . |.||   ...|.  |. .  
Sbjct: 399 -----ERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMY 453

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEI 177
             .. |. .|. ..   .|...    | |.   ..  .     |  ...  . .    |.
Sbjct: 454 GQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSNITVNEDQIKLMNVAI---NEL 510

Query: 178 TVEMKQITVEVKQEITVEMKQITEETCS 205
            ... | |   |...  |.  | || |.
Sbjct: 511 NIKL-QDTNSQKEKLKEELGLILEEKCA 537

>hg18||uc003ulf
        |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP_671714|A-kinase
        anchor protein 9 isoform 3

          Length = 3899

 Score =  51 bits (120), Expect = 1e-006
 Identities = 48/208 (23%), Positives = 110/208 (52%), Gaps = 18/208 (8%)

Query:   4 ITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQ 63
           | ||.  .|  | |. |.|.| ..|   | .  |....| |.  |  . || |.|   ..
Sbjct: 330 IIEELNTKIIEEEKK-TLELKDKLTTADK-LLGELQEQI-VQKNQEIKNMKLELTNSKQK 386

Query:  64 ITVEVKQEITVEMKQI--TVEVKQEITVEMKQ----ITEEMKQEITVEMKQITVEVKKEI 117
                ... . |.||.  |||  |.   .  |    | . |.||   ...|.  |. .  
Sbjct: 387 -----ERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMY 441

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEI 177
             .. |. .|. ..   .|...    | |.   ..  .     |  ...  . .    |.
Sbjct: 442 GQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSNITVNEDQIKLMNVAI---NEL 498

Query: 178 TVEMKQITVEVKQEITVEMKQITEETCS 205
            ... | |   |...  |.  | || |.
Sbjct: 499 NIKL-QDTNSQKEKLKEELGLILEEKCA 525

>hg18||uc003ulg
        |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3907

 Score =  51 bits (120), Expect = 1e-006
 Identities = 48/208 (23%), Positives = 110/208 (52%), Gaps = 18/208 (8%)

Query:   4 ITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQ 63
           | ||.  .|  | |. |.|.| ..|   | .  |....| |.  |  . || |.|   ..
Sbjct: 330 IIEELNTKIIEEEKK-TLELKDKLTTADK-LLGELQEQI-VQKNQEIKNMKLELTNSKQK 386

Query:  64 ITVEVKQEITVEMKQI--TVEVKQEITVEMKQ----ITEEMKQEITVEMKQITVEVKKEI 117
                ... . |.||.  |||  |.   .  |    | . |.||   ...|.  |. .  
Sbjct: 387 -----ERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMY 441

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEI 177
             .. |. .|. ..   .|...    | |.   ..  .     |  ...  . .    |.
Sbjct: 442 GQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSNITVNEDQIKLMNVAI---NEL 498

Query: 178 TVEMKQITVEVKQEITVEMKQITEETCS 205
            ... | |   |...  |.  | || |.
Sbjct: 499 NIKL-QDTNSQKEKLKEELGLILEEKCA 525

>hg18||uc003ulh
        |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|NP_671700|A-kinase
        anchor protein 9 isoform 1

          Length = 3911

 Score =  51 bits (120), Expect = 1e-006
 Identities = 48/208 (23%), Positives = 110/208 (52%), Gaps = 18/208 (8%)

Query:   4 ITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQ 63
           | ||.  .|  | |. |.|.| ..|   | .  |....| |.  |  . || |.|   ..
Sbjct: 342 IIEELNTKIIEEEKK-TLELKDKLTTADK-LLGELQEQI-VQKNQEIKNMKLELTNSKQK 398

Query:  64 ITVEVKQEITVEMKQI--TVEVKQEITVEMKQ----ITEEMKQEITVEMKQITVEVKKEI 117
                ... . |.||.  |||  |.   .  |    | . |.||   ...|.  |. .  
Sbjct: 399 -----ERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMY 453

Query: 118 TVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEI 177
             .. |. .|. ..   .|...    | |.   ..  .     |  ...  . .    |.
Sbjct: 454 GQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSNITVNEDQIKLMNVAI---NEL 510

Query: 178 TVEMKQITVEVKQEITVEMKQITEETCS 205
            ... | |   |...  |.  | || |.
Sbjct: 511 NIKL-QDTNSQKEKLKEELGLILEEKCA 537

>hg18||uc002kte
        |18|NM_005406|Q13464|ROCK1_HUMAN|ROCK1|NM_005406|NP_005397|Rho-associat
        ed, coiled-coil containing protein

          Length = 1354

 Score =  50 bits (119), Expect = 2e-006
 Identities = 45/191 (23%), Positives = 94/191 (49%), Gaps = 13/191 (6%)

Query:  16 MKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMK-QEITVEMKQITVEVKQEIT- 73
           .| .  ..||||        .| |. .  |. |.|.. .  |  .   |  .| .|  . 
Sbjct: 800 LKGLEKQMKQEINT-----LLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFST 854

Query:  74 ---VEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQ 130
               ..|..  |....    .|.| |   .. |.  .    | | |     . . ||   
Sbjct: 855 LYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYF 914

Query: 131 EITVEMKQITEEMKQEITVEMKQIT--EEMKKEITVEMKQITVEVKKEITVEMKQITVEV 188
           |.| | |.     .|||| .   ..  ||    .| ... .  |  .|.| .||.   | 
Sbjct: 915 ELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRE-NEELTEKMKKAEEEY 973

Query: 189 KQEITVEMKQI 199
           | |   |.  .
Sbjct: 974 KLEKEEEISNL 984

>hg18||uc002kte
        |18|NM_005406|Q13464|ROCK1_HUMAN|ROCK1|NM_005406|NP_005397|Rho-associat
        ed, coiled-coil containing protein

          Length = 1354

 Score =  48 bits (113), Expect = 8e-006
 Identities = 43/203 (21%), Positives = 93/203 (45%), Gaps = 3/203 (1%)

Query:    1 MKQITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVE 60
            .|.. ||....    .|.|     .. |.  .    | | |     . . ||   |.| |
Sbjct:  860 VKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQE 919

Query:   61 MKQITVEVKQEITVEMKQIT-VEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITV 119
             |.     .|||| .   .. .|    .  .  .|     .|.| .||.   | | |   
Sbjct:  920 SKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEE 979

Query:  120 EMKQITEEMKQEITVEMKQITEEM-KQEITVEMKQITEEMKKEITVEMKQITVEVKKEIT 178
            |.  .    .. |  |    |. . |    .  |    . ||  | ....   | .| . 
Sbjct:  980 EISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRK-LQ 1038

Query:  179 VEMKQITVEVKQEITVEMKQITE 201
            .|. |   .  | .    |.. .
Sbjct: 1039 LELNQEREKFNQMVVKHQKELND 1061

>hg18||uc003ule |7|NM_147166|NA|NA|AKAP9|NM_147166|NP_671695|A-kinase anchor
        protein 9 isoform 4

          Length = 1655

 Score =  46 bits (108), Expect = 3e-005
 Identities = 47/204 (23%), Positives = 100/204 (49%), Gaps = 21/204 (10%)

Query:  14 VEMKQITVEVKQEITV------EMKQITVEVKQEITVEMKQIT--EEMKQEITVEMKQI- 64
           .| .. |.|.| ..|       |...  |.  |||     ..|  .. ... . |.||. 
Sbjct: 351 IEEEKKTLELKDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLM 410

Query:  65 -TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQ 123
            |||  |.   .  |   .. | .  | ..  |... |.     |  |..|.|.  .   
Sbjct: 411 GTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMA 470

Query: 124 ITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEV-----KKEIT 178
             ||||     ||.         |||   ||     | . | . .. ...     .||  
Sbjct: 471 QMEEMKTRHKGEMENALRSY-SNITVNEDQI-----KLMNVAINELNIKLQDTNSQKEKL 524

Query: 179 VEMKQITVEVKQEITVEMKQITEE 202
            |   . .| |  .  ... . ||
Sbjct: 525 KEELGLILEEKCALQRQLEDLVEE 548

>hg18||uc003ulf
        |7|NM_147185|Q99996-3|Q99996-3|AKAP9|NM_147185|NP_671714|A-kinase
        anchor protein 9 isoform 3

          Length = 3899

 Score =  46 bits (108), Expect = 3e-005
 Identities = 47/204 (23%), Positives = 100/204 (49%), Gaps = 21/204 (10%)

Query:  14 VEMKQITVEVKQEITV------EMKQITVEVKQEITVEMKQIT--EEMKQEITVEMKQI- 64
           .| .. |.|.| ..|       |...  |.  |||     ..|  .. ... . |.||. 
Sbjct: 339 IEEEKKTLELKDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLM 398

Query:  65 -TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQ 123
            |||  |.   .  |   .. | .  | ..  |... |.     |  |..|.|.  .   
Sbjct: 399 GTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMA 458

Query: 124 ITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEV-----KKEIT 178
             ||||     ||.         |||   ||     | . | . .. ...     .||  
Sbjct: 459 QMEEMKTRHKGEMENALRSY-SNITVNEDQI-----KLMNVAINELNIKLQDTNSQKEKL 512

Query: 179 VEMKQITVEVKQEITVEMKQITEE 202
            |   . .| |  .  ... . ||
Sbjct: 513 KEELGLILEEKCALQRQLEDLVEE 536

>hg18||uc003ulg
        |7|NM_005751|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3907

 Score =  46 bits (108), Expect = 3e-005
 Identities = 47/204 (23%), Positives = 100/204 (49%), Gaps = 21/204 (10%)

Query:  14 VEMKQITVEVKQEITV------EMKQITVEVKQEITVEMKQIT--EEMKQEITVEMKQI- 64
           .| .. |.|.| ..|       |...  |.  |||     ..|  .. ... . |.||. 
Sbjct: 339 IEEEKKTLELKDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLM 398

Query:  65 -TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQ 123
            |||  |.   .  |   .. | .  | ..  |... |.     |  |..|.|.  .   
Sbjct: 399 GTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMA 458

Query: 124 ITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEV-----KKEIT 178
             ||||     ||.         |||   ||     | . | . .. ...     .||  
Sbjct: 459 QMEEMKTRHKGEMENALRSY-SNITVNEDQI-----KLMNVAINELNIKLQDTNSQKEKL 512

Query: 179 VEMKQITVEVKQEITVEMKQITEE 202
            |   . .| |  .  ... . ||
Sbjct: 513 KEELGLILEEKCALQRQLEDLVEE 536

>hg18||uc003ulh
        |7|NM_147171|Q99996|AKAP9_HUMAN|AKAP9|NM_147171|NP_671700|A-kinase
        anchor protein 9 isoform 1

          Length = 3911

 Score =  46 bits (108), Expect = 3e-005
 Identities = 47/204 (23%), Positives = 100/204 (49%), Gaps = 21/204 (10%)

Query:  14 VEMKQITVEVKQEITV------EMKQITVEVKQEITVEMKQIT--EEMKQEITVEMKQI- 64
           .| .. |.|.| ..|       |...  |.  |||     ..|  .. ... . |.||. 
Sbjct: 351 IEEEKKTLELKDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLM 410

Query:  65 -TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQ 123
            |||  |.   .  |   .. | .  | ..  |... |.     |  |..|.|.  .   
Sbjct: 411 GTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMA 470

Query: 124 ITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEV-----KKEIT 178
             ||||     ||.         |||   ||     | . | . .. ...     .||  
Sbjct: 471 QMEEMKTRHKGEMENALRSY-SNITVNEDQI-----KLMNVAINELNIKLQDTNSQKEKL 524

Query: 179 VEMKQITVEVKQEITVEMKQITEE 202
            |   . .| |  .  ... . ||
Sbjct: 525 KEELGLILEEKCALQRQLEDLVEE 548

>hg18||uc001tck |12|NM_003566|Q15075|EEA1_HUMAN|EEA1|NM_003566|NP_003557|early
        endosome antigen 1, 162kD

          Length = 1411

 Score =  40 bits (93), Expect = 0.002
 Identities = 43/194 (22%), Positives = 97/194 (50%), Gaps = 17/194 (8%)

Query:    9 KQEITVEMKQITVEVKQEITVEMKQITV-----EVKQEITVEMKQITEEMKQEITVEMKQ 63
            | |.  ...|   .  ||.  | ..|.|     |  ||   ...      . |. .  .|
Sbjct:  989 KTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESEL-LATRQ 1047

Query:   64 ITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQ 123
                |......  . . .  . .|  . | | |    . |.|  | . . ....    | 
Sbjct: 1048 DLKSVEEKLSLAQEDL-ISNRNQIGNQNKLIQELKTAKATLE--QDSAKKEQQLQERCKA 1104

Query:  124 ITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEIT---VEMKQITVEVKKEIT-- 178
            . .  |..   | . . |. |     |...|    .||||    |.|   .|  ||||  
Sbjct: 1105 LQDIQKEKSLKEKELVNEKSK---LAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNL 1161

Query:  179 VEMKQITVEVKQEI 192
             . ||. .. | |.
Sbjct: 1162 KDAKQLLIQQKLEL 1175

>hg18||uc002hvi
        |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|NP_000412|keratin 10

          Length = 584

 Score =  40 bits (93), Expect = 0.002
 Identities = 35/165 (21%), Positives = 80/165 (48%), Gaps = 11/165 (6%)

Query:  38 VKQEITVEMKQITEEMKQEITVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEE 97
           .| |  | ..|  |     .   . ..|.  | .. .... .|    .|.    |   ||
Sbjct: 236 LKYENEVALRQSVEADINGLRRVLDELTL-TKADLEMQIESLT----EELAYLKKNHEEE 290

Query:  98 MKQEITVEMKQITVEVKKEITVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEE 157
           ||    |    . ||.     |.. |.   |.     . .|. |. ...      . ..|
Sbjct: 291 MKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRS----QYEQLAEQNRKDAEAWFNEKSKE 346

Query: 158 MKKEITVEMKQITVEVKKEITVEMKQI-TVEVKQEITVEMKQITE 201
           .  ||   ..||.   | |||   . .  .|.. .  . .||  |
Sbjct: 347 LTTEIDNNIEQIS-SYKSEITELRRNVQALEIELQSQLALKQSLE 390

>hg18||uc001wyi |14|NM_020921|Q8N4C6-7|Q8N4C6-7|NIN|NM_020921|NP_065972|ninein
        isoform 2

          Length = 2116

 Score =  40 bits (91), Expect = 0.003
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query:    7 EMKQEITVEMK--QITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQI 64
            | ..|.   |   |||    |.    ..  . ...|| ..   .||   ...    .|  
Sbjct: 1469 EKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLG 1528

Query:   65 TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQ--EITVEMKQITVEVKKEITVEMK 122
            |.   ||   || | |  ||||     | .    ||  |. .. .|. .|   |.. .  
Sbjct: 1529 TLNGSQE---EMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLE-NTELSQKNS 1584

Query:  123 QITE---EMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEI---TVEMKQITVEVKKE 176
            |  |   |. | .|  . |  .|       | .|    .|.|.    |.   .   .. |
Sbjct: 1585 QNQEKLQELNQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAE 1644

Query:  177 ITVEMKQITVEVKQE 191
            .. |.|  |  |.||
Sbjct: 1645 LS-EVKIQTHIVQQE 1658

>hg18||uc001wyl |14|NM_016350|Q8N4C6|NIN_HUMAN|NIN|NM_016350|NP_057434|ninein
        isoform 4

          Length = 2096

 Score =  40 bits (91), Expect = 0.003
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query:    7 EMKQEITVEMK--QITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQI 64
            | ..|.   |   |||    |.    ..  . ...|| ..   .||   ...    .|  
Sbjct: 1492 EKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLG 1551

Query:   65 TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQ--EITVEMKQITVEVKKEITVEMK 122
            |.   ||   || | |  ||||     | .    ||  |. .. .|. .|   |.. .  
Sbjct: 1552 TLNGSQE---EMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLE-NTELSQKNS 1607

Query:  123 QITE---EMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEI---TVEMKQITVEVKKE 176
            |  |   |. | .|  . |  .|       | .|    .|.|.    |.   .   .. |
Sbjct: 1608 QNQEKLQELNQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAE 1667

Query:  177 ITVEMKQITVEVKQE 191
            .. |.|  |  |.||
Sbjct: 1668 LS-EVKIQTHIVQQE 1681

>hg18||uc001wym |14|NM_182945|Q8N4C6|NIN_HUMAN|NIN|NM_182945|NP_891990|ninein
        isoform 3

          Length = 2073

 Score =  40 bits (91), Expect = 0.003
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query:    7 EMKQEITVEMK--QITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQI 64
            | ..|.   |   |||    |.    ..  . ...|| ..   .||   ...    .|  
Sbjct: 1469 EKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLG 1528

Query:   65 TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQ--EITVEMKQITVEVKKEITVEMK 122
            |.   ||   || | |  ||||     | .    ||  |. .. .|. .|   |.. .  
Sbjct: 1529 TLNGSQE---EMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLE-NTELSQKNS 1584

Query:  123 QITE---EMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEI---TVEMKQITVEVKKE 176
            |  |   |. | .|  . |  .|       | .|    .|.|.    |.   .   .. |
Sbjct: 1585 QNQEKLQELNQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAE 1644

Query:  177 ITVEMKQITVEVKQE 191
            .. |.|  |  |.||
Sbjct: 1645 LS-EVKIQTHIVQQE 1658

>hg18||uc001wyo |14|NM_182944|Q8N4C6|NIN_HUMAN|NIN|NM_182944|NP_891989|ninein
        isoform 1

          Length = 2029

 Score =  40 bits (91), Expect = 0.003
 Identities = 49/195 (25%), Positives = 93/195 (47%), Gaps = 15/195 (7%)

Query:    7 EMKQEITVEMK--QITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQI 64
            | ..|.   |   |||    |.    ..  . ...|| ..   .||   ...    .|  
Sbjct: 1469 EKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLG 1528

Query:   65 TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQ--EITVEMKQITVEVKKEITVEMK 122
            |.   ||   || | |  ||||     | .    ||  |. .. .|. .|   |.. .  
Sbjct: 1529 TLNGSQE---EMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLE-NTELSQKNS 1584

Query:  123 QITE---EMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEI---TVEMKQITVEVKKE 176
            |  |   |. | .|  . |  .|       | .|    .|.|.    |.   .   .. |
Sbjct: 1585 QNQEKLQELNQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAE 1644

Query:  177 ITVEMKQITVEVKQE 191
            .. |.|  |  |.||
Sbjct: 1645 LS-EVKIQTHIVQQE 1658

>hg18||uc003zqg
        |9|NM_025103|A0PJM7|A0PJM7_HUMAN|IFT74|NM_025103|NP_079379|coiled-coil
        domain containing 2

          Length = 435

 Score =  40 bits (91), Expect = 0.003
 Identities = 42/176 (23%), Positives = 92/176 (52%), Gaps = 9/176 (5%)

Query:   5 TEEMKQEITVEMKQITVEVKQEITVE-MKQITVEVKQEITVEMKQITEEMKQEITVEMKQ 63
           ||   .|  .   .  .| ... | . .| ...|  |   .|||   |.. ||.    .|
Sbjct:  27 TERQAKEKQIRSVEEEIEQEKQATDDIIKNMSLE-NQVKYLEMKTTNEKLLQELDTLQQQ 85

Query:  64 ITVEVKQEITVEMKQITVEVKQEITVEMKQI--TEEMKQEITVEMKQITVEVKKEITVEM 121
           .  .  .. ..| .    .||||  .  ...   |  . ..  | | |   ...   . .
Sbjct:  86 LDSQNMKKESLEAEIAHSQVKQEAVLLHEKLYELESHRDQMIAEDKSIGSPMEEREKL-L 144

Query: 122 KQITEEMKQEITVEMKQITE--EMKQEITVEMKQITEEMKKEITVEMKQITVEVKK 175
           ||| ..  |||    .|.|.  |   .   |..|.  .. .|   || |   |.||
Sbjct: 145 KQIKDD-NQEIASMERQLTDTKEKINQFIEEIRQLDMDL-EEHQGEMNQKYKELKK 198

>hg18||uc001wyk |14|BC090932|Q5BKU3|Q5BKU3_HUMAN|NIN|NM_182946|NP_891991|ninein
        isoform 5

          Length = 1377

 Score =  39 bits (88), Expect = 0.006
 Identities = 46/185 (24%), Positives = 89/185 (48%), Gaps = 13/185 (7%)

Query:  15 EMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKQEITV 74
           |...  .|  |    | .  . ...|| ..   .||   ...    .|  |.   ||   
Sbjct: 783 ELRKELLEKHQRELQEGRYESEKLQQENSILRNEITTLNEEDSISNLKLGTLNGSQE--- 839

Query:  75 EMKQITVEVKQEITVEMKQITEEMKQ--EITVEMKQITVEVKKEITVEMKQITE---EMK 129
           || | |  ||||     | .    ||  |. .. .|. .|   |.. .  |  |   |. 
Sbjct: 840 EMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLE-NTELSQKNSQNQEKLQELN 898

Query: 130 QEITVEMKQITEEMKQEITVEMKQITEEMKKEI---TVEMKQITVEVKKEITVEMKQITV 186
           | .|  . |  .|       | .|    .|.|.    |.   .   .. |.. |.|  | 
Sbjct: 899 QRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAELS-EVKIQTH 957

Query: 187 EVKQE 191
            |.||
Sbjct: 958 IVQQE 962

>hg18||uc002xsr |20|AK001175|NA|NA|ZMYND8|NM_183048|NP_898869|zinc finger,
        MYND-type containing 8 isoform c

          Length = 285

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct:  20 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 78

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct:  79 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 124

>hg18||uc002xss |20|DQ368674|Q2HXV7|Q2HXV7_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1161

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:   26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
            ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct:  896 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 954

Query:   82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
            |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct:  955 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 1000

>hg18||uc002xst |20|DQ368677|Q2HXV4|Q2HXV4_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1068

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 803 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 861

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 862 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 907

>hg18||uc002xsu |20|DQ082999|Q9ULU4-8|Q9ULU4-8|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1087

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 794 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 852

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 853 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 898

>hg18||uc002xsv |20|DQ368680|Q2HXV1|Q2HXV1_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1114

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 849 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 907

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 908 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 953

>hg18||uc002xsw |20|DQ368675|NA|NA|KIAA1125|NA|NA|Homo sapiens mRNA for KIAA1125
        protein, partial cds

          Length = 920

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 627 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 685

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 686 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 731

>hg18||uc002xsx |20|DQ368676|NA|NA|KIAA1125|NA|NA|Homo sapiens mRNA for KIAA1125
        protein, partial cds

          Length = 892

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 627 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 685

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 686 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 731

>hg18||uc002xsy |20|DQ368672|Q2HXV9|Q2HXV9_HUMAN|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1143

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 850 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 908

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 909 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 954

>hg18||uc002xsz |20|AK122966|Q9ULU4-6|Q9ULU4-6|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1105

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 812 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 870

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 871 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 916

>hg18||uc002xta |20|AB032951|Q9ULU4|PKCB1_HUMAN|ZMYND8|NM_012408|NP_036540|zinc
        finger, MYND-type containing 8 isoform b

          Length = 1186

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:   26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
            ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct:  921 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 979

Query:   82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
            |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct:  980 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 1025

>hg18||uc002xtb
        |20|NM_183047|Q2HXW2|Q2HXW2_HUMAN|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1188

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 895 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 953

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 954 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 999

>hg18||uc002xtc
        |20|NM_012408|Q2HXW1|Q2HXW1_HUMAN|ZMYND8|NM_012408|NP_036540|zinc
        finger, MYND-type containing 8 isoform b

          Length = 1160

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 895 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 953

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 954 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 999

>hg18||uc002xtd
        |20|NM_183048|Q2HXW0|Q2HXW0_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1135

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 870 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 928

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 929 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 974

>hg18||uc002xte |20|BX641005|Q9ULU4-9|Q9ULU4-9|PRKCBP1|NA|NA|Protein kinase
        C-binding protein 1 (Rack7) (Cutaneous T-cell lymphoma- associated
        antigen se14-3) (CTCL tumor antigen se14-3) (Zinc finger MYND
        domain-containing protein 8)

          Length = 1168

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:  26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
           ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct: 875 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 933

Query:  82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
           |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 934 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 979

>hg18||uc002xtf |20|AK225857|Q2HXV8|Q2HXV8_HUMAN|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1234

 Score =  39 bits (88), Expect = 0.006
 Identities = 22/110 (20%), Positives = 60/110 (54%), Gaps = 9/110 (8%)

Query:   26 EITVEMKQITVEVKQEITVEMKQITEEMKQEIT----VEMKQITVEVKQEITVEMKQITV 81
            ..  .. . | ..   |   | .|  .. .  |     |.... .|...   .  .... 
Sbjct:  941 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 999

Query:   82 EVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQE 131
            |.|  . . |     ||.| .  |  ..  ||||.. .| .|  .| |..
Sbjct: 1000 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 1045

>hg18||uc003wla
        |7|NM_170606|Q8NEZ4|MLL3_HUMAN|MLL3|NM_170606|NP_733751|myeloid/lymphoi
        d or mixed-lineage leukemia 3

          Length = 4911

 Score =  39 bits (88), Expect = 0.006
 Identities = 31/167 (18%), Positives = 80/167 (47%), Gaps = 3/167 (1%)

Query:  13 TVEMKQITVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKQEI 72
           ...   . . |  . ||   ..  ..  |.  |  ... |.|     .  .  .|| . |
Sbjct: 595 SLDTDSLLIAVSSQHTVN-TELEKQISNEVDSEDLKMSSEVKHICGEDQIEDKMEVTENI 653

Query:  73 TVEMKQITVEVKQEITVEMKQ--ITEEMKQEITVEMKQITVEVKKEITVEMKQITEEMKQ 130
            |   ||||. .|   .|  .  .. |  .   . |. .|. ..  ..   . |.   ..
Sbjct: 654 EVVTHQITVQQEQLQLLEEPETVVSREESRPPKLVMESVTLPLETLVSPHEESISLCPEE 713

Query: 131 EITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEI 177
           .. .|  |  .| |.   .    .  ||   |   .| .. .  | |
Sbjct: 714 QLVIERLQGEKEQKENSELSTGLMDSEMTPTIEGCVKDVSYQGGKSI 760

>hg18||uc002hvi
        |17|NM_000421|P13645|K1C10_HUMAN|KRT10|NM_000421|NP_000412|keratin 10

          Length = 584

 Score =  38 bits (87), Expect = 0.008
 Identities = 40/202 (19%), Positives = 96/202 (47%), Gaps = 16/202 (7%)

Query:   8 MKQEITVEMKQITVEVKQEITVEMKQITVEVK---QEITVEMKQITEEMKQEITVEMKQI 64
           ..| .  ..  .   |  |.|.    . ....   .|.    |   ||||    |    .
Sbjct: 244 LRQSVEADINGLR-RVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDV 302

Query:  65 TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMKQITVEVKKEITVEMKQI 124
            ||.     |.. |.   ..     . .|. |. ...      . . |.  ||   ..||
Sbjct: 303 NVEMNAAPGVDLTQLLNNMRS----QYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQI 358

Query: 125 TEEMKQEITVEMKQITE-EMKQEITVEMKQITE----EMKKEITVEMKQITVEVKKEITV 179
           .   | |||   . .   |.. .  . .||  |    | .    |.. ||  ..   .  
Sbjct: 359 S-SYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQI-SALEE 416

Query: 180 EMKQITVEVKQEITVEMKQITE 201
           ...||  | . . | | .|. .
Sbjct: 417 QLQQIRAETECQNT-EYQQLLD 437

>hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3530

 Score =  37 bits (85), Expect = 0.014
 Identities = 36/160 (22%), Positives = 77/160 (48%), Gaps = 13/160 (8%)

Query:  50 TEEMKQEITVEMKQI--TVEVKQEITVEMKQITVEVKQEITVEMKQITEEMKQEITVEMK 107
           ... ... . |.||.  |||  |.   .  |   .. | .  | ..  |... |.     
Sbjct:   8 SKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYG 67

Query: 108 QITVEVKKEITVEMKQITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMK 167
           |  |..|.|.  .     ||||     ||.         |||   ||     | . | . 
Sbjct:  68 QQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSY-SNITVNEDQI-----KLMNVAIN 121

Query: 168 QITVEV-----KKEITVEMKQITVEVKQEITVEMKQITEE 202
           .. ...     .||   |   . .| |  .  ... . ||
Sbjct: 122 ELNIKLQDTNSQKEKLKEELGLILEEKCALQRQLEDLVEE 161

>hg18||uc003uli |7|AF083037|Q99996-2|Q99996-2|AKAP9|NM_005751|NP_005742|A-kinase
        anchor protein 9 isoform 2

          Length = 3530

 Score =  37 bits (83), Expect = 0.024
 Identities = 29/143 (20%), Positives = 74/143 (51%), Gaps = 10/143 (6%)

Query:  69 KQEITVEMKQI--TVEVKQEITVEMKQ----ITEEMKQEITVEMKQITVEVKKEITVEMK 122
           ... . |.||.  |||  |.   .  |    | . |.||   ...|.  |. .    .. 
Sbjct:  12 ERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIV 71

Query: 123 QITEEMKQEITVEMKQITEEMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMK 182
           |. .|. ..   .|...    | |.   ..  .     |  ...  . .    |. ... 
Sbjct:  72 QMKQELIRQHMAQMEEMKTRHKGEMENALRSYSNITVNEDQIKLMNVAI---NELNIKL- 127

Query: 183 QITVEVKQEITVEMKQITEETCS 205
           | |   |...  |.  | || |.
Sbjct: 128 QDTNSQKEKLKEELGLILEEKCA 150

>hg18||uc002xsr |20|AK001175|NA|NA|ZMYND8|NM_183048|NP_898869|zinc finger,
        MYND-type containing 8 isoform c

          Length = 285

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct:  20 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 78

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct:  79 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 124

>hg18||uc002xss |20|DQ368674|Q2HXV7|Q2HXV7_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1161

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:   86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
            ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct:  896 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 954

Query:  142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
            |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct:  955 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 1000

>hg18||uc002xst |20|DQ368677|Q2HXV4|Q2HXV4_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1068

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 803 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 861

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 862 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 907

>hg18||uc002xsu |20|DQ082999|Q9ULU4-8|Q9ULU4-8|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1087

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 794 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 852

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 853 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 898

>hg18||uc002xsv |20|DQ368680|Q2HXV1|Q2HXV1_HUMAN|ZMYND8|NM_183048|NP_898869|zinc
        finger, MYND-type containing 8 isoform c

          Length = 1114

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 849 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 907

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 908 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 953

>hg18||uc002xsw |20|DQ368675|NA|NA|KIAA1125|NA|NA|Homo sapiens mRNA for KIAA1125
        protein, partial cds

          Length = 920

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 627 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 685

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 686 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 731

>hg18||uc002xsx |20|DQ368676|NA|NA|KIAA1125|NA|NA|Homo sapiens mRNA for KIAA1125
        protein, partial cds

          Length = 892

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 627 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 685

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 686 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 731

>hg18||uc002xsy |20|DQ368672|Q2HXV9|Q2HXV9_HUMAN|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1143

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 850 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 908

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 909 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 954

>hg18||uc002xsz |20|AK122966|Q9ULU4-6|Q9ULU4-6|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1105

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 812 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 870

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 871 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 916

>hg18||uc002xta |20|AB032951|Q9ULU4|PKCB1_HUMAN|ZMYND8|NM_012408|NP_036540|zinc
        finger, MYND-type containing 8 isoform b

          Length = 1186

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:   86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
            ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct:  921 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 979

Query:  142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
            |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct:  980 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 1025

>hg18||uc002xtb
        |20|NM_183047|Q2HXW2|Q2HXW2_HUMAN|ZMYND8|NM_183047|NP_898868|zinc
        finger, MYND-type containing 8 isoform a

          Length = 1188

 Score =  36 bits (82), Expect = 0.032
 Identities = 24/110 (21%), Positives = 58/110 (52%), Gaps = 9/110 (8%)

Query:  86 EITVEMKQITEEMKQEITVEMKQITVEVKKEIT----VEMKQITEEMKQEITVEMKQITE 141
           ..  .. . | .|   |   | .|  .. |  |     |....  |...   .  .... 
Sbjct: 895 DVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELS- 953

Query: 142 EMKQEITVEMKQITEEMKKEITVEMKQITVEVKKEITVEMKQITVEVKQE 191
           |||  . . |     ||.. .  |  ..  ||||.. .| .|   | |..
Sbjct: 954 EMKHNLELTM----AEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKK 999

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0