BLASTP 7.6.0


Query=fugu4_746965 |jgi|Takru4|746965|fgh5_pg.C_scaffold_4558000002
        (132 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc001yta |14|X58398|NA|NA|LOC90925|NA|NA|Homo sapiens hypo...     79   2e-015
hg18||uc001ysz |14|X58402|NA|NA|immunoglobulin |NA|NA|Human CLL-...     78   2e-015
hg18||uc001yuj |15|AY671312|Q86SX2|Q86SX2_HUMAN|IGH|NA|NA|Full-l...     76   1e-014
hg18||uc001ytb |14|AK129787|Q6PIL0|Q6PIL0_HUMAN|IGHV7-81|NA|NA|I...     72   1e-013
hg18||uc002stp |2|DQ101095|P04434|KV310_HUMAN|IGKV3-15|NA|NA|Ig ...     55   3e-008
hg18||uc002zxt |22|NM_013378|Q9UKI3|VPRE3_HUMAN|VPREB3|NM_013378...     46   1e-005
hg18||uc001wcd |14|M97714|NA|NA|TCRAV8.1a|NA|NA|Homo sapiens T c...     45   2e-005
hg18||uc001wdu |14|X13951|A0JD36|A0JD36_HUMAN|hDV102S1|NA|NA|HDV...     41   3e-004
hg18||uc002zvx |22|NM_007128|P12018|VPREB_HUMAN|VPREB1|NM_007128...     41   3e-004
hg18||uc002stn |2|AF049690|A1BLL5|A1BLL5_HUMAN|IGVK-A2|NA|NA|V k...     37   0.006
hg18||uc003tge |7|BC072396|Q6IN96|Q6IN96_HUMAN|TRGV9|NA|NA|TRGV9...     34   0.036
hg18||uc001wdr |14|S69312|NA|NA|TCR-alpha|NA|NA|Homo sapiens TCR...     33   0.105
hg18||uc001wcx |14|X61628|NA|NA|TCRA|NA|NA|Homo sapiens MUC1-spe...     32   0.235
hg18||uc001egv |1|NM_020440|Q9P2B2|FPRP_HUMAN|PTGFRN|NM_020440|N...     29   1.523
hg18||uc001wbp |14|M17663|NA|NA|TCRA|NA|NA|Homo sapiens T-cell r...     27   4.431
hg18||uc002stl |2|X72492|P06312|KV401_HUMAN|IGKV4-1|NA|NA|Ig kap...     27   5.787
hg18||uc001wbm |14|L06879|NA|NA|TCRA|NA|NA|full-length cDNA clon...     27   7.559
hg18||uc001wct |14|AK127936|NA|NA|TRA|NA|NA|Homo sapiens TRA mRN...     27   7.559
hg18||uc003pvt |6|NM_002290|Q16363-2|Q16363-2|LAMA4|NM_002290|NP...     26   9.872
hg18||uc003pvu |6|AB210027|Q16363|LAMA4_HUMAN|LAMA4|NM_002290|NP...     26   9.872
hg18||uc003pvv |6|BC066552|Q16363-2|Q16363-2|LAMA4|NM_002290|NP_...     26   9.872
hg18||uc003vxp |7|D13083|A0A539|A0A539_HUMAN|TCRBV7S3A2|NA|NA|V_...     26   9.872
hg18||uc003vxv |7|X62856|A0A589|A0A589_HUMAN|TCRBV7S2A1N4T|NA|NA...     26   9.872

>hg18||uc001yta |14|X58398|NA|NA|LOC90925|NA|NA|Homo sapiens hypothetical
        protein LOC90925, mRNA (cDNA clone MGC:3963 IMAGE:3621362), complete
        cds

          Length = 120

 Score =  79 bits (192), Expect = 2e-015
 Identities = 43/99 (43%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query:  19 QLTQPASVPVQPGQRLTITCQVS-YSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPI-YKA 76
           || | |.   .||. | |.|. | || .|.  ||.||  || |||.|.   | .   |  
Sbjct:  22 QLLQSAAEVKRPGESLRISCKTSGYSFTSYWIHWVRQMPGKELEWMGSIYPGNSDTRYSP 81

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTI 115
           | |   .|| ||||.|  |   ...  | |.||| | ||
Sbjct:  82 SFQGHVTISADSSSSTAYLQWSSLKASDAAMYYCVRGTI 120

>hg18||uc001ysz |14|X58402|NA|NA|immunoglobulin |NA|NA|Human CLL-12 transcript
        of unrearranged immunoglobulin V(H)5 gene

          Length = 128

 Score =  78 bits (191), Expect = 2e-015
 Identities = 43/105 (40%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query:  19 QLTQPASVPVQPGQRLTITCQVS-YSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPI-YKA 76
           || |  .   .||. | |.|. | || .|.   |.||  ||||||.|    | .   |  
Sbjct:  22 QLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSP 81

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTITQTTNE 121
           | | . .|| | | .|  |   ...  |||.||||| |. .|. |
Sbjct:  82 SFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARHTVRETSPE 126

>hg18||uc001yuj |15|AY671312|Q86SX2|Q86SX2_HUMAN|IGH|NA|NA|Full-length cDNA
        clone CS0DL004YM19 of B cells (Ramos cell line) of Homo sapiens (human)
        (Fragment)

          Length = 117

 Score =  76 bits (185), Expect = 1e-014
 Identities = 42/96 (43%), Positives = 57/96 (59%), Gaps = 2/96 (2%)

Query:  19 QLTQPASVPVQPGQRLTITCQVSYS--VSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKA 76
           || .     |.| . |..|| ||     ||.   |.||| ||||||||      .| |  
Sbjct:  22 QLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNP 81

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCAR 112
           ||... .||.| | |  .|   .|   | |||||||
Sbjct:  82 SLKSRVTISVDKSKNQFSLKLSSVTAADRAVYYCAR 117

>hg18||uc001ytb |14|AK129787|Q6PIL0|Q6PIL0_HUMAN|IGHV7-81|NA|NA|IGHV7-81
        protein

          Length = 125

 Score =  72 bits (176), Expect = 1e-013
 Identities = 39/121 (32%), Positives = 65/121 (53%), Gaps = 2/121 (1%)

Query:   2 FSVXXXXXXXXGCVKCEQLTQPASVPVQPGQRLTITCQVS-YSVSSHHTHWIRQPAGKGL 60
           .|.        |     || |      |||  . ..|. | || ...  .|. |  |.||
Sbjct:   5 WSILFLVAAATGTYSQVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGL 64

Query:  61 EWIG-AHRVGYNPIYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTITQTT 119
           ||.|  .    || |      .|  |.|.|..|  |   ... || |.||||| |. . |
Sbjct:  65 EWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCARYTMWKPT 124

Query: 120 N 120
           .
Sbjct: 125 S 125

>hg18||uc002stp |2|DQ101095|P04434|KV310_HUMAN|IGKV3-15|NA|NA|Ig kappa chain
        V-III region VH precursor (Fragment)

          Length = 92

 Score =  55 bits (130), Expect = 3e-008
 Identities = 32/92 (34%), Positives = 54/92 (58%), Gaps = 8/92 (8%)

Query:  23 PASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKAS-LQNK 81
           ||.. . ||.| |..|. | |||| .  | .|  |.         . |    .|. .  .
Sbjct:   5 PATLSLSPGERATLSCRASQSVSSSYLSWYQQKPGQ-----APRLLIYGASTRATGIPAR 59

Query:  82 FSISLDSSSNTVTLNGVNVQPEDTAVYYCARD 113
           || |   .  |.|..  ..|||| ||||| .|
Sbjct:  60 FSGSGSGTDFTLTIS--SLQPEDFAVYYCQQD 89

>hg18||uc002zxt
        |22|NM_013378|Q9UKI3|VPRE3_HUMAN|VPREB3|NM_013378|NP_037510|pre-B
        lymphocyte gene 3

          Length = 123

 Score =  46 bits (107), Expect = 1e-005
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 3/95 (3%)

Query:  20 LTQPASVPVQPGQRLTITCQVS---YSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKA 76
           | |  .. | |||   ..| .|    ..  .   | .| ||    ..  .|   .    |
Sbjct:  22 LAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPA 81

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA 111
            . ..|| . | . |   |    ||||| | |||.
Sbjct:  82 DIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCS 116

>hg18||uc001wcd |14|M97714|NA|NA|TCRAV8.1a|NA|NA|Homo sapiens T cell receptor
        alpha locus, mRNA (cDNA clone IMAGE:30418790), partial cds

          Length = 112

 Score =  45 bits (106), Expect = 2e-005
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query:  23 PASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKASLQNKF 82
           |... || |    | |  | | |..   | .|  ||| . |    .            . 
Sbjct:  27 PSTLSVQEGDSAVIKCTYSDSASNYFP-WYKQELGKGPQLI----IDIRSNVGEKKDQRI 81

Query:  83 SISLDSSSNTVTLNGVNVQPEDTAVYYCA 111
           ...|. ..   .|.    ||||.|||.||
Sbjct:  82 AVTLNKTAKHFSLHITETQPEDSAVYFCA 110

>hg18||uc001wdu |14|X13951|A0JD36|A0JD36_HUMAN|hDV102S1|NA|NA|HDV102S1
        (Fragment)

          Length = 115

 Score =  41 bits (95), Expect = 3e-004
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query:  18 EQLTQPASVPVQPGQRLTITCQV-SYSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKA 76
           | . .  .|||  |   |. | .   .. ... .| |.  |  . .|   .  | | .| 
Sbjct:  22 ELVPEHQTVPVSIGVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYREKDIYGPGFKD 81

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDT 114
           . |      .| . |   |  .     |   |||| ||
Sbjct:  82 NFQG----DIDIAKNLAVLKILAPSERDEGSYYCACDT 115

>hg18||uc002zvx
        |22|NM_007128|P12018|VPREB_HUMAN|VPREB1|NM_007128|NP_009059|immunoglobu
        lin iota chain preproprotein

          Length = 145

 Score =  41 bits (95), Expect = 3e-004
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 2/113 (1%)

Query:  13 GCVKCEQLTQPASVPVQPGQRLTITCQV--SYSVSSHHTHWIRQPAGKGLEWIGAHRVGY 70
           ||     | || ..    |  . .|| .   . .  .  .| .|  |    ..  .    
Sbjct:  16 GCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQS 75

Query:  71 NPIYKASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCARDTITQTTNEEE 123
           .      .  .|| | | . |   |.   .|||| |.||||    .    | |
Sbjct:  76 DKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEERE 128

>hg18||uc002stn |2|AF049690|A1BLL5|A1BLL5_HUMAN|IGVK-A2|NA|NA|V kappa
        (Fragment)

          Length = 97

 Score =  37 bits (84), Expect = 0.006
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query:  23 PASVPVQPGQRLTITCQVSYSV----SSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKASL 78
           | |. | |||  .|.|. | |.       . .|  |  |.  . .         ||. | 
Sbjct:   5 PLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLL---------IYEVS- 54

Query:  79 QNKFS-----ISLDSSSNTVTLNGVNVQPEDTAVYYC 110
            |.||      |   |    ||    |. ||  ||||
Sbjct:  55 -NRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC 90

>hg18||uc003tge |7|BC072396|Q6IN96|Q6IN96_HUMAN|TRGV9|NA|NA|TRGV9 protein

          Length = 315

 Score =  34 bits (77), Expect = 0.036
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query:  36 ITCQVS-YSVSSHHTHWIRQPAGKGLEWIGAHRVGYNPIYKASL---QNKFSISLDSSSN 91
           . | ||  ..|.   .| |.  |. .... .  . |.   .        || .     ..
Sbjct:  41 LECVVSGITISATSVYWYRERPGEVIQFLVS--ISYDGTVRKESGIPSGKFEVDRIPETS 98

Query:  92 TVTLNGVNVQPEDTAVYYCA 111
           | ||   ||. .| | ||||
Sbjct:  99 TSTLTIHNVEKQDIATYYCA 118

>hg18||uc001wdr |14|S69312|NA|NA|TCR-alpha|NA|NA|Homo sapiens TCR alpha chain
        (TCR-alpha) mRNA, TCR V alpha 7, J alpha 17.11, C alpha allele partial
        cds

          Length = 111

 Score =  33 bits (73), Expect = 0.105
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 16 KCEQLTQPASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGL 60
          | |    | ..  | |. .|| |  ||||     ||..|  | |.
Sbjct: 23 KNEVEQSPQNLTAQEGEFITINC--SYSVGISALHWLQQHPGGGI 65

>hg18||uc001wcx |14|X61628|NA|NA|TCRA|NA|NA|Homo sapiens MUC1-specific T cell
        receptor alpha mRNA, complete cds

          Length = 111

 Score =  32 bits (70), Expect = 0.235
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 18 EQLTQ-PASVPVQPGQRLTITCQVSYSVSSHHTHWIRQPAGKGL 60
          ...|| ||.. |  |. | . |  . | . ..  | ||  ||||
Sbjct: 21 QEVTQIPAALSVPEGENLVLNCSFTDS-AIYNLQWFRQDPGKGL 63

>hg18||uc001egv
        |1|NM_020440|Q9P2B2|FPRP_HUMAN|PTGFRN|NM_020440|NP_065173|prostaglandin
        F2 receptor negative regulator

          Length = 879

 Score =  29 bits (63), Expect = 1.523
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 6/102 (5%)

Query:  31 GQRLTITCQVS--YSVSSHHTHWIRQPAGKG-LEWIGAHRVGY-NPIYKASLQNKFSISL 86
           |  | | | ||     |  .  |     |   .|      ||.   .|.  ||    .  
Sbjct:  36 GTELVIPCNVSDYDGPSEQNFDWSFSSLGSSFVELASTWEVGFPAQLYQERLQRGEILLR 95

Query:  87 DSSSNTVTLNGVNVQPEDTAVYYCARDTITQTT--NEEEASQ 126
            .... | |.  |||| |   | |.  .   |   | |.  |
Sbjct:  96 RTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDTVQ 137

>hg18||uc001wbp |14|M17663|NA|NA|TCRA|NA|NA|Homo sapiens T-cell receptor alpha
        (TCRA) mRNA (HLA-A3, 29; B7, 44; DR 2, 7), partial cds

          Length = 106

 Score =  27 bits (59), Expect = 4.431
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query:  74 YKASLQNKFS---ISLDSSSNTVTLNGVNVQPEDTAVYYC 110
           ||  . |. .   |  |  |.|..|  |..   |||||||
Sbjct:  68 YKTKVTNEVASLFIPADRKSSTLSLPRVSL--SDTAVYYC 105

>hg18||uc002stl |2|X72492|P06312|KV401_HUMAN|IGKV4-1|NA|NA|Ig kappa chain V-IV
        region precursor (Fragment)

          Length = 121

 Score =  27 bits (58), Expect = 5.787
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query:  75 KASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYC 110
           .. . ..|| |   .  |.|..  ..| || |||||
Sbjct:  81 ESGVPDRFSGSGSGTDFTLTIS--SLQAEDVAVYYC 114

>hg18||uc001wbm |14|L06879|NA|NA|TCRA|NA|NA|full-length cDNA clone CS0DL010YA18
        of B cells (Ramos cell line) Cot 25-normalized of Homo sapiens (human)

          Length = 119

 Score =  27 bits (57), Expect = 7.559
 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query:  75 KASLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA 111
           | | | ..... .  |... .  . |.  | ||||||
Sbjct:  76 KPSQQGRYNMTYERFSSSLLI--LQVREADAAVYYCA 110

>hg18||uc001wct |14|AK127936|NA|NA|TRA|NA|NA|Homo sapiens TRA mRNA for T cell
        receptor alpha chain, partial cds, allele:TRAV19*01+TRAJ53*01

          Length = 136

 Score =  27 bits (57), Expect = 7.559
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query:  82 FSISLDSSSNTVTLNGVNVQPEDTAVYYCA-RDTITQT 118
           |  |   | ..  |   .||  |.|||||| || .  |
Sbjct:  80 FQASPIKSDSSFHLEKPSVQLSDSAVYYCALRDRVGGT 117

>hg18||uc003pvt
        |6|NM_002290|Q16363-2|Q16363-2|LAMA4|NM_002290|NP_002281|laminin, alpha
        4 precursor

          Length = 1816

 Score =  26 bits (56), Expect = 9.872
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query:   74 YKASLQNKFSISLDSSSNTVTLNGVNVQPED 104
            | ||  . ||||||. .  . . |. ||  |
Sbjct: 1267 YYASGSDVFSISLDNGTVIMDVKGIKVQSVD 1297

>hg18||uc003pvu
        |6|AB210027|Q16363|LAMA4_HUMAN|LAMA4|NM_002290|NP_002281|laminin, alpha
        4 precursor

          Length = 1823

 Score =  26 bits (56), Expect = 9.872
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query:   74 YKASLQNKFSISLDSSSNTVTLNGVNVQPED 104
            | ||  . ||||||. .  . . |. ||  |
Sbjct: 1274 YYASGSDVFSISLDNGTVIMDVKGIKVQSVD 1304

>hg18||uc003pvv |6|BC066552|Q16363-2|Q16363-2|LAMA4|NM_002290|NP_002281|laminin,
        alpha 4 precursor

          Length = 1816

 Score =  26 bits (56), Expect = 9.872
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query:   74 YKASLQNKFSISLDSSSNTVTLNGVNVQPED 104
            | ||  . ||||||. .  . . |. ||  |
Sbjct: 1267 YYASGSDVFSISLDNGTVIMDVKGIKVQSVD 1297

>hg18||uc003vxp |7|D13083|A0A539|A0A539_HUMAN|TCRBV7S3A2|NA|NA|V_segment
        translation product (Fragment)

          Length = 113

 Score =  26 bits (56), Expect = 9.872
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA 111
           |. ..||    .||. . |.   .||||.|.| ||
Sbjct:  78 SVPSRFSPECPNSSH-LFLHLHTLQPEDSALYLCA 111

>hg18||uc003vxv |7|X62856|A0A589|A0A589_HUMAN|TCRBV7S2A1N4T|NA|NA|V_segment
        translation product (Fragment)

          Length = 114

 Score =  26 bits (56), Expect = 9.872
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query:  77 SLQNKFSISLDSSSNTVTLNGVNVQPEDTAVYYCA 111
           |. ..||    .||. . |.   .||||.|.| ||
Sbjct:  78 SVPSRFSPECPNSSH-LFLHLHTLQPEDSALYLCA 111

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,827,316
Number of Sequences: 45480
Number of Extensions: 191827316
Number of Successful Extensions: 11130448
Number of sequences better than 0.0: 0
BLASTP 7.6.0