BLASTP 7.6.0


Query=fugu4_746949 |jgi|Takru4|746949|fgh5_pg.C_scaffold_4533000001
        (238 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003jpl |5|NM_002104|P49863|GRAK_HUMAN|GZMK|NM_002104|NP_...    188   7e-048
hg18||uc003jpm |5|NM_006144|P12544|GRAA_HUMAN|GZMA|NM_006144|NP_...    186   2e-047
hg18||uc002pua |19|NM_004917|Q9Y5K2|KLK4_HUMAN|KLK4|NM_004917|NP...    162   5e-040
hg18||uc003wak |7|NM_002769|P07477|TRY1_HUMAN|PRSS1|NM_002769|NP...    161   1e-039
hg18||uc002puq |19|NM_144505|O60259-2|O60259-2|KLK8|NM_144505|NP...    159   4e-039
hg18||uc002pur |19|NM_007196|O60259|NRPN_HUMAN|KLK8|NM_007196|NP...    159   4e-039
hg18||uc002puu |19|BC040887|O60259|NRPN_HUMAN|KLK8|NM_007196|NP_...    159   4e-039
hg18||uc003zti |9|AY052783|Q7Z5F4|Q7Z5F4_HUMAN|PRSS3|NA|NA|Prote...    158   6e-039
hg18||uc003ztl |9|NM_002771|Q5JT15|Q5JT15_HUMAN|PRSS3|NM_002771|...    158   6e-039
hg18||uc003wao |7|NR_001296|Q8NHM4|Q8NHM4_HUMAN|TRY6|NA|NA|Tryps...    156   3e-038
hg18||uc002pue |19|NM_001077491|Q9Y337|KLK5_HUMAN|KLK5|NM_001077...    154   8e-038
hg18||uc002puf |19|NM_001077492|Q9Y337|KLK5_HUMAN|KLK5|NM_001077...    154   8e-038
hg18||uc002pug |19|NM_012427|Q9Y337|KLK5_HUMAN|KLK5|NM_012427|NP...    154   8e-038
hg18||uc002pvc |19|AB259014|Q9UBX7-1|Q9UBX7-1|KLK11|NM_006853|NP...    154   1e-037
hg18||uc002pvd |19|NM_144947|Q9UBX7|KLK11_HUMAN|KLK11|NM_144947|...    154   1e-037
hg18||uc002pvf |19|NM_006853|Q9UBX7-1|Q9UBX7-1|KLK11|NM_006853|N...    154   1e-037
hg18||uc002pvn |19|NM_015596|Q9UKR3|KLK13_HUMAN|KLK13|NM_015596|...    154   1e-037
hg18||uc001wpr |14|NM_033423|P20718|GRAH_HUMAN|GZMH|NM_033423|NP...    153   2e-037
hg18||uc001wps |14|NM_004131|P10144|GRAB_HUMAN|GZMB|NM_004131|NP...    153   2e-037
hg18||uc003wal |7|BC103998|Q3SY20|Q3SY20_HUMAN|PRSS2|NM_002770|N...    149   3e-036
hg18||uc002pvs |19|NM_022046|Q9P0G3|KLK14_HUMAN|KLK14|NM_022046|...    148   1e-035
hg18||uc003wap |7|NM_002770|P07478|TRY2_HUMAN|PRSS2|NM_002770|NP...    146   2e-035
hg18||uc002lqc |19|NM_001928|Q5U5S1|Q5U5S1_HUMAN|CFD|NM_001928|N...    145   5e-035
hg18||uc001wpp |14|NM_001836|P23946|CMA1_HUMAN|CMA1|NM_001836|NP...    143   2e-034
hg18||uc001wpq |14|NM_001911|P08311|CATG_HUMAN|CTSG|NM_001911|NP...    138   6e-033
hg18||uc002puh |19|DQ223012|Q6H301|Q6H301_HUMAN|KLK6|NM_002774|N...    138   8e-033
hg18||uc002pui |19|NM_001012964|Q92876|KLK6_HUMAN|KLK6|NM_001012...    138   8e-033
hg18||uc002pul |19|NM_002774|Q92876|KLK6_HUMAN|KLK6|NM_002774|NP...    138   8e-033
hg18||uc002fds |16|NM_001906|Q6GPI1|Q6GPI1_HUMAN|CTRB1|NM_001906...    135   5e-032
hg18||uc002puo |19|NM_139277|P49862|KLK7_HUMAN|KLK7|NM_139277|NP...    135   5e-032
hg18||uc002pup |19|NM_005046|P49862|KLK7_HUMAN|KLK7|NM_005046|NP...    135   5e-032
hg18||uc002low |19|NM_005317|P51124|GRAM_HUMAN|GZMM|NM_005317|NP...    134   1e-031
hg18||uc002fdr |16|NM_001025200|P17538|CTRB1_HUMAN|CTRB2|NM_0010...    132   3e-031
hg18||uc002euw |16|NM_001907|P40313|CTRL_HUMAN|CTRL|NM_001907|NP...    124   1e-028
hg18||uc003wam |7|BC035777|NA|NA|PRSS1|NM_002769|NP_002760|prote...    121   1e-027
hg18||uc001prs |11|NM_001077263|Q1RMF8|Q1RMF8_HUMAN|TMPRSS13|NM_...    119   4e-027
hg18||uc001prt |11|AB048796|Q9BYE2|TMPSD_HUMAN|TMPRSS13|NA|NA|Tr...    119   4e-027
hg18||uc001rix |12|NM_183378|Q7RTY7|OVCH1_HUMAN|OVCH1|NM_183378|...    115   5e-026
hg18||uc002pub |19|AY923170|Q9Y5K2|KLK4_HUMAN|KLK4|NM_004917|NP_...    115   7e-026
hg18||uc002pvb |19|AB261897|Q8IXD7|Q8IXD7_HUMAN|KLK11|NM_006853|...    115   7e-026
hg18||uc002lpz |19|NM_001700|P20160|CAP7_HUMAN|AZU1|NM_001700|NP...    114   9e-026
hg18||uc001lai |10|NM_004132|Q14520|HABP2_HUMAN|HABP2|NM_004132|...    113   2e-025
hg18||uc003ghc |4|NM_001528|Q04756|HGFA_HUMAN|HGFAC|NM_001528|NP...    113   2e-025
hg18||uc003qtl |6|NM_005577|Q5VTD7|Q5VTD7_HUMAN|LPA|NM_005577|NP...    111   1e-024
hg18||uc002cky |16|NM_024164|NA|NA|TPSB2|NM_024164|NP_077078|try...    108   9e-024
hg18||uc002ckz |16|NM_003294|Q15661|TRYB1_HUMAN|TPSAB1|NM_003294...    107   1e-023
hg18||uc002cla |16|AF206667|Q15661-2|Q15661-2|TPSAB1|NM_003294|N...    102   4e-022
hg18||uc001jwa |10|NM_002658|Q5SWW9|Q5SWW9_HUMAN|PLAU|NM_002658|...    101   1e-021
hg18||uc001jwc |10|M15476|Q5SWW9|Q5SWW9_HUMAN|PLAU|NM_002658|NP_...    101   1e-021
hg18||uc003mgo |5|NM_000505|P00748|FA12_HUMAN|F12|NM_000505|NP_0...    100   2e-021
hg18||uc002ykw |21|NM_002772|P98073|ENTK_HUMAN|PRSS7|NM_002772|N...    100   2e-021
hg18||uc002ptv |19|NM_005551|P20151|KLK2_HUMAN|KLK2|NM_005551|NP...     96   3e-020
hg18||uc002clb |16|NM_012217|Q9BZJ3|TRYD_HUMAN|TPSD1|NM_012217|N...     96   3e-020
hg18||uc002ptr |19|NM_001030048|Q8NCW4|Q8NCW4_HUMAN|KLK3|NM_0010...     93   2e-019
hg18||uc002pve |19|BC015551|NA|NA|KLK11|NA|NA|Homo sapiens mRNA ...     92   5e-019
hg18||uc003ztj |9|BC030238|P35030-2|P35030-2|PRSS3|NM_002771|NP_...     91   1e-018
hg18||uc001bfk |1|NM_007352|P08861|ELA3B_HUMAN|ELA3B|NM_007352|N...     91   1e-018
hg18||uc002ptk |19|NM_002257|Q86U61|Q86U61_HUMAN|KLK1|NM_002257|...     89   3e-018
hg18||uc002pvr |19|AL050220|NA|NA|KLK13|NM_015596|NP_056411|kall...     89   3e-018
hg18||uc002pvg |19|AY358524|Q9UKR0|KLK12_HUMAN|KLK12|NM_145894|N...     88   9e-018
hg18||uc002pvi |19|NM_145894|Q9UKR0|KLK12_HUMAN|KLK12|NM_145894|...     88   9e-018
hg18||uc002pvh |19|NM_019598|Q9UKR0-2|Q9UKR0-2|KLK12|NM_019598|N...     84   1e-016
hg18||uc003bnh |22|NM_001097|P10323|ACRO_HUMAN|ACR|NM_001097|NP_...     82   5e-016
hg18||uc002pun |19|AY646152|P49862-2|P49862-2|KLK7|NA|NA|Kallikr...     81   1e-015
hg18||uc002puy |19|NM_145888|Q53YL3|Q53YL3_HUMAN|KLK10|NM_145888...     80   3e-015
hg18||uc002puz |19|NM_002776|Q53YL3|Q53YL3_HUMAN|KLK10|NM_002776...     80   3e-015
hg18||uc002pva |19|NM_001077500|Q53YL3|Q53YL3_HUMAN|KLK10|NM_001...     80   3e-015
hg18||uc002puj |19|NM_001012965|Q6H301|Q6H301_HUMAN|KLK6|NM_0010...     78   7e-015
hg18||uc002puk |19|AY318868|NA|NA|KLK6|NM_001012965|NP_001012983...     78   7e-015
hg18||uc002pum |19|AY279383|NA|NA|KLK6|NM_001012965|NP_001012983...     78   7e-015
hg18||uc002pus |19|NM_144506|Q9NR68|Q9NR68_HUMAN|KLK8|NM_144506|...     78   7e-015
hg18||uc002ptq |19|NM_001030049|Q6LDS3|Q6LDS3_HUMAN|KLK3|NM_0010...     73   2e-013
hg18||uc002pts |19|NM_001030047|Q15096|Q15096_HUMAN|KLK3|NM_0010...     73   2e-013
hg18||uc002crf |16|NM_031948|Q9BQR3|PRS27_HUMAN|PRSS27|NM_031948...     69   4e-012
hg18||uc002pux |19|NM_012315|Q9UKQ9|KLK9_HUMAN|KLK9|NM_012315|NP...     69   4e-012
hg18||uc002ptl |19|NM_017509|Q9H2R5|KLK15_HUMAN|KLK15|NM_017509|...     69   6e-012
hg18||uc002pto |19|BC069480|Q6ISI0|Q6ISI0_HUMAN|KLK15|NM_017509|...     69   6e-012
hg18||uc002ptt |19|NM_001002232|P20151-3|P20151-3|KLK2|NM_001002...     66   3e-011
hg18||uc002ptu |19|NM_001002231|P20151-2|P20151-2|KLK2|NM_001002...     66   3e-011
hg18||uc002ptv |19|NM_005551|P20151|KLK2_HUMAN|KLK2|NM_005551|NP...     66   3e-011
hg18||uc002ckx |16|AF206666|NA|NA|TPSAB1|NA|NA|Homo sapiens mast...     66   4e-011
hg18||uc001bfl |1|NM_005747|P09093|ELA3A_HUMAN|ELA3A|NM_005747|N...     64   2e-010
hg18||uc002ptq |19|NM_001030049|Q6LDS3|Q6LDS3_HUMAN|KLK3|NM_0010...     63   2e-010
hg18||uc002ptp |19|NM_001030050|NA|NA|KLK3|NM_001030050|NP_00102...     54   1e-007
hg18||uc002ptr |19|NM_001030048|Q8NCW4|Q8NCW4_HUMAN|KLK3|NM_0010...     54   1e-007
hg18||uc003qtm |6|NM_000301|P00747|PLMN_HUMAN|PLG|NM_000301|NP_0...     54   1e-007
hg18||uc002pvb |19|AB261897|Q8IXD7|Q8IXD7_HUMAN|KLK11|NM_006853|...     52   7e-007
hg18||uc001rwx |12|NM_182559|Q86WS5|Q86WS5_HUMAN|TMPRSS12|NM_182...     51   1e-006
hg18||uc001rwy |12|BC035123|Q49AN6|Q49AN6_HUMAN|TMPRSS12|NA|NA|T...     51   1e-006
hg18||uc001pru |11|AK027798|Q9BYE2-4|Q9BYE2-4|TMPRSS13|NA|NA|Tra...     51   1e-006
hg18||uc001mfo |11|NM_198185|Q7RTZ1|OVCH2_HUMAN|OVCH2|NM_198185|...     48   8e-006
hg18||uc002cro |16|NM_152891|Q8N171|Q8N171_HUMAN|PRSS33|NM_15289...     47   2e-005
hg18||uc002crp |16|AX721175|NA|NA|PRSS33|NA|NA|Homo sapiens seri...     47   2e-005
hg18||uc002crq |16|BC036846|Q8N171|Q8N171_HUMAN|PRSS33|NM_152891...     47   2e-005
hg18||uc002ebd |16|NM_173502|Q5K4E3|POLS2_HUMAN|PRSS36|NM_173502...     46   4e-005
hg18||uc002yzj |21|NM_005656|Q6GTK7|Q6GTK7_HUMAN|TMPRSS2|NM_0056...     45   5e-005
hg18||uc001psb |11|NM_019894|Q9NRS4|TMPS4_HUMAN|TMPRSS4|NM_01989...     45   7e-005
hg18||uc001psc |11|NM_183247|NA|NA|TMPRSS4|NM_183247|NP_899070|t...     45   7e-005
hg18||uc002ckw |16|NM_012467|Q9NRR2|TRYG1_HUMAN|TPSG1|NM_012467|...     45   7e-005
hg18||uc002lqb |19|NM_001972|P08246|ELNE_HUMAN|ELA2|NM_001972|NP...     44   2e-004

>hg18||uc003jpl |5|NM_002104|P49863|GRAK_HUMAN|GZMK|NM_002104|NP_002095|granzyme
        K precursor

          Length = 264

 Score =  188 bits (476), Expect = 7e-048
 Identities = 103/234 (44%), Positives = 139/234 (59%), Gaps = 15/234 (6%)

Query:  11 EIIGGKEVKPHSMPYMALVK-TATGICGGTLINPKWVLTAAHCE------KVTTEALGVH 63
           |||||||| ||| |.|| ..     .||| ||.|.||||||||.      .  |  || |
Sbjct:  26 EIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAH 85

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           |. . | | |   .   ||.         ||.|..||.||||  |.|| ||. | |   .
Sbjct:  86 SLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRS-KTSLR 144

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECS--KYYSPNRVITKAMICAGSK- 179
           .|| |   ||| |.      || |  | |||. |  |.   ||. .  ||| |.|||   
Sbjct: 145 SGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAK 204

Query: 180 -NKDTCQGDSGGPLLCNGALVGVTSFGRGCGRA--PGVYAYITEEHLRWIKKTI 230
             ||.|.|||||||.| |    . | |  || |  ||.|  .|...  |||  .
Sbjct: 205 GQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNL 258

>hg18||uc003jpm |5|NM_006144|P12544|GRAA_HUMAN|GZMA|NM_006144|NP_006135|granzyme
        A precursor

          Length = 262

 Score =  186 bits (472), Expect = 2e-047
 Identities = 108/233 (46%), Positives = 137/233 (58%), Gaps = 13/233 (5%)

Query:  11 EIIGGKEVKPHSMPYMALVK-TATGICGGTLINPKWVLTAAHC--EKVTTEALGVHSI-R 66
           .|||| || ||| ||| |.      || | ||   ||||||||   | .   || ||| |
Sbjct:  28 KIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITR 87

Query:  67 QKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTGTS 126
           .. . |.  |    ||| |.  | . || .|.|   ||  | |  |||     . | || 
Sbjct:  88 EEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTM 147

Query: 127 CLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECS--KYYSPNRVITKAMICAGS--KNKD 182
           |  ||||.|. .    || |  ||.|..||  |.   .|. | ||   |.||||    .|
Sbjct: 148 CQVAGWGRTHNSA-SWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRD 206

Query: 183 TCQGDSGGPLLCNGALVGVTSFG--RGCG--RAPGVYAYITEEHLRWIKKTIR 231
           .| |||| |||| |   ||||||    ||  | ||||  ....|| ||  ||.
Sbjct: 207 SCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIK 259

>hg18||uc002pua
        |19|NM_004917|Q9Y5K2|KLK4_HUMAN|KLK4|NM_004917|NP_004908|kallikrein-rel
        ated peptidase 4 preproprotein

          Length = 254

 Score =  162 bits (408), Expect = 5e-040
 Identities = 95/233 (40%), Positives = 137/233 (58%), Gaps = 16/233 (6%)

Query:  10 SEIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHC-EKVTTEALGVHSIR- 66
           |.|| |..  ||| |.  |||      | | |..|.|||.|||| .   |  ||.||.  
Sbjct:  29 SQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQNSYTIGLGLHSLEA 88

Query:  67 -QKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTGT 125
            |.   |.   . |. .| |||    ||||..||. .  ..  .. . . |  . |  | 
Sbjct:  89 DQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIAS--QCPTAGN 146

Query: 126 SCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGS--KNKDT 183
           ||| .|||    |   .  ||  |||.||    ||| | |  .   .| |||     ||.
Sbjct: 147 SCLVSGWGLL--ANGRMPTVLQCVNVSVVSEEVCSKLYDP--LYHPSMFCAGGGHDQKDS 202

Query: 184 CQGDSGGPLLCNGALVGVTSFGRG-CGR--APGVYAYITEEHLRWIKKTIRTS 233
           | |||||||.||| | |. |||.  ||.   ||||  .  .   ||.||.. |
Sbjct: 203 CNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLC-KFTEWIEKTVQAS 254

>hg18||uc003wak
        |7|NM_002769|P07477|TRY1_HUMAN|PRSS1|NM_002769|NP_002760|protease,
        serine, 1 preproprotein

          Length = 247

 Score =  161 bits (405), Expect = 1e-039
 Identities = 90/232 (38%), Positives = 131/232 (56%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . .    |||.||| .||..| || |   .  || |
Sbjct:  17 PFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEH 76

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|   | . |       | .| |.||| .||.|..|| . |     |  . |  |   | 
Sbjct:  77 NIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISL--PTAPPA 134

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
           ||| || .||| |  .  .  | |  ..  |. . .|   | | . ||  | | |     
Sbjct: 135 TGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASY-PGK-ITSNMFCVGFLEGG 192

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCGR--APGVYAYITEEHLRWIKKTI 230
           ||.||||||||..||| | || |.| || .   ||||  .   ...||| ||
Sbjct: 193 KDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKV-YNYVKWIKNTI 243

>hg18||uc002puq
        |19|NM_144505|O60259-2|O60259-2|KLK8|NM_144505|NP_653088|kallikrein 8
        isoform 2

          Length = 305

 Score =  159 bits (400), Expect = 4e-039
 Identities = 97/230 (42%), Positives = 130/230 (56%), Gaps = 15/230 (6%)

Query:  11 EIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQK 68
           ...|| | .||| |.  || .    .||| |.   ||||||||.|   |  || ||.. |
Sbjct:  77 KVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNK 136

Query:  69 ES-WQVFRVTHSIPYPAYNR---KTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           .   |   |  |||.| ||    . ...|||.|.|   |     || . |     .|  |
Sbjct: 137 DGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQP--G 194

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG-SKNKDT 183
             |  .|||      .   | |    | .  . .|   |     ||  |.||| ||  ||
Sbjct: 195 QKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQ--ITDGMVCAGSSKGADT 252

Query: 184 CQGDSGGPLLCNGALVGVTSFGRG-CGRA--PGVYAYITEEHLRWIKKTI 230
           |||||||||.|.||| |.||.|   |||.  ||||  |   .| |||| |
Sbjct: 253 CQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNIC-RYLDWIKKII 301

>hg18||uc002pur
        |19|NM_007196|O60259|NRPN_HUMAN|KLK8|NM_007196|NP_009127|kallikrein 8
        isoform 1 preproprotein

          Length = 260

 Score =  159 bits (400), Expect = 4e-039
 Identities = 97/230 (42%), Positives = 130/230 (56%), Gaps = 15/230 (6%)

Query:  11 EIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQK 68
           ...|| | .||| |.  || .    .||| |.   ||||||||.|   |  || ||.. |
Sbjct:  32 KVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNK 91

Query:  69 ES-WQVFRVTHSIPYPAYNR---KTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           .   |   |  |||.| ||    . ...|||.|.|   |     || . |     .|  |
Sbjct:  92 DGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQP--G 149

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG-SKNKDT 183
             |  .|||      .   | |    | .  . .|   |     ||  |.||| ||  ||
Sbjct: 150 QKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQ--ITDGMVCAGSSKGADT 207

Query: 184 CQGDSGGPLLCNGALVGVTSFGRG-CGRA--PGVYAYITEEHLRWIKKTI 230
           |||||||||.|.||| |.||.|   |||.  ||||  |   .| |||| |
Sbjct: 208 CQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNIC-RYLDWIKKII 256

>hg18||uc002puu
        |19|BC040887|O60259|NRPN_HUMAN|KLK8|NM_007196|NP_009127|kallikrein 8
        isoform 1 preproprotein

          Length = 260

 Score =  159 bits (400), Expect = 4e-039
 Identities = 97/230 (42%), Positives = 130/230 (56%), Gaps = 15/230 (6%)

Query:  11 EIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQK 68
           ...|| | .||| |.  || .    .||| |.   ||||||||.|   |  || ||.. |
Sbjct:  32 KVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNK 91

Query:  69 ES-WQVFRVTHSIPYPAYNR---KTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           .   |   |  |||.| ||    . ...|||.|.|   |     || . |     .|  |
Sbjct:  92 DGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQP--G 149

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG-SKNKDT 183
             |  .|||      .   | |    | .  . .|   |     ||  |.||| ||  ||
Sbjct: 150 QKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQ--ITDGMVCAGSSKGADT 207

Query: 184 CQGDSGGPLLCNGALVGVTSFGRG-CGRA--PGVYAYITEEHLRWIKKTI 230
           |||||||||.|.||| |.||.|   |||.  ||||  |   .| |||| |
Sbjct: 208 CQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNIC-RYLDWIKKII 256

>hg18||uc003zti |9|AY052783|Q7Z5F4|Q7Z5F4_HUMAN|PRSS3|NA|NA|Protease serine 4
        isoform B

          Length = 261

 Score =  158 bits (399), Expect = 6e-039
 Identities = 90/232 (38%), Positives = 129/232 (55%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . . .  |||.||. .||..|||| |   .  || |
Sbjct:  31 PFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEH 90

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|.  | . |       | .| ||| | |||.|..|| . |     |  . |  |   | 
Sbjct:  91 NIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISL--PTTPPA 148

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
            || || .||| |     .  | |  ..  |. . ||   | | . || .| | |     
Sbjct: 149 AGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASY-PGK-ITNSMFCVGFLEGG 206

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCG--RAPGVYAYITEEHLRWIKKTI 230
           ||.|| |||||..||| | || |.| ||     ||||  .   .. ||| ||
Sbjct: 207 KDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKV-YNYVDWIKDTI 257

>hg18||uc003ztl
        |9|NM_002771|Q5JT15|Q5JT15_HUMAN|PRSS3|NM_002771|NP_002762|mesotrypsin
        preproprotein

          Length = 247

 Score =  158 bits (399), Expect = 6e-039
 Identities = 90/232 (38%), Positives = 129/232 (55%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . . .  |||.||. .||..|||| |   .  || |
Sbjct:  17 PFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEH 76

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|.  | . |       | .| ||| | |||.|..|| . |     |  . |  |   | 
Sbjct:  77 NIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISL--PTAPPA 134

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
            || || .||| |     .  | |  ..  |. . ||   | | . || .| | |     
Sbjct: 135 AGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASY-PGK-ITNSMFCVGFLEGG 192

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCG--RAPGVYAYITEEHLRWIKKTI 230
           ||.|| |||||..||| | || |.| ||     ||||  .   .. ||| ||
Sbjct: 193 KDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKV-YNYVDWIKDTI 243

>hg18||uc003wao |7|NR_001296|Q8NHM4|Q8NHM4_HUMAN|TRY6|NA|NA|Trypsinogen C

          Length = 247

 Score =  156 bits (393), Expect = 3e-038
 Identities = 88/232 (37%), Positives = 128/232 (55%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . . .  |||.||. .||..| || |   .  || |
Sbjct:  17 PFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYKPHIQVRLGEH 76

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|   | . |       | .| ||| | .||.|..|| | |    .|  . |  |   | 
Sbjct:  77 NIEVLEGNEQFINAAKIIRHPKYNRITLNNDIMLIKLSTPAVINAHVSTISL--PTAPPA 134

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
            || || .||| |  .  .  | |  ..  |. . .|   |     ||  | | |     
Sbjct: 135 AGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLK--ITSKMFCVGFLEGG 192

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCG--RAPGVYAYITEEHLRWIKKTI 230
           ||.||||||||..||| | |. |.| ||   | ||||  .   .. ||| ||
Sbjct: 193 KDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKV-YNYVDWIKDTI 243

>hg18||uc002pue
        |19|NM_001077491|Q9Y337|KLK5_HUMAN|KLK5|NM_001077491|NP_001070959|kalli
        krein-related peptidase 5 preproprotein

          Length = 293

 Score =  154 bits (389), Expect = 8e-038
 Identities = 89/233 (38%), Positives = 135/233 (57%), Gaps = 14/233 (6%)

Query:  10 SEIIGGKEVKPHSMPYMA--LVKTATGICGGTLINPKWVLTAAHC-EKVTTEALGVHSIR 66
           | || | .   |. |. |  |..     ||  |..|.|.|||||| .||    || .|. 
Sbjct:  65 SRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLS 124

Query:  67 --QKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
              .   |.|.   |||.| |.   . ||||..||    . ||.|. ... |    |  |
Sbjct: 125 PVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSS--HCPSAG 182

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK-NKDT 183
           | || .||| |         ||  .|..|. .  |   |   | |   | ||| |  .|.
Sbjct: 183 TKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYP--RQIDDTMFCAGDKAGRDS 240

Query: 184 CQGDSGGPLLCNGALVGVTSFG-RGCGR--APGVYAYITEEHLRWIKKTIRTS 233
           ||||||||..|||.| |. |.|   | |   ||||  .  .  .||..||. .
Sbjct: 241 CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLC-KFTKWIQETIQAN 292

>hg18||uc002puf
        |19|NM_001077492|Q9Y337|KLK5_HUMAN|KLK5|NM_001077492|NP_001070960|kalli
        krein-related peptidase 5 preproprotein

          Length = 293

 Score =  154 bits (389), Expect = 8e-038
 Identities = 89/233 (38%), Positives = 135/233 (57%), Gaps = 14/233 (6%)

Query:  10 SEIIGGKEVKPHSMPYMA--LVKTATGICGGTLINPKWVLTAAHC-EKVTTEALGVHSIR 66
           | || | .   |. |. |  |..     ||  |..|.|.|||||| .||    || .|. 
Sbjct:  65 SRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLS 124

Query:  67 --QKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
              .   |.|.   |||.| |.   . ||||..||    . ||.|. ... |    |  |
Sbjct: 125 PVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSS--HCPSAG 182

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK-NKDT 183
           | || .||| |         ||  .|..|. .  |   |   | |   | ||| |  .|.
Sbjct: 183 TKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYP--RQIDDTMFCAGDKAGRDS 240

Query: 184 CQGDSGGPLLCNGALVGVTSFG-RGCGR--APGVYAYITEEHLRWIKKTIRTS 233
           ||||||||..|||.| |. |.|   | |   ||||  .  .  .||..||. .
Sbjct: 241 CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLC-KFTKWIQETIQAN 292

>hg18||uc002pug
        |19|NM_012427|Q9Y337|KLK5_HUMAN|KLK5|NM_012427|NP_036559|kallikrein-rel
        ated peptidase 5 preproprotein

          Length = 293

 Score =  154 bits (389), Expect = 8e-038
 Identities = 89/233 (38%), Positives = 135/233 (57%), Gaps = 14/233 (6%)

Query:  10 SEIIGGKEVKPHSMPYMA--LVKTATGICGGTLINPKWVLTAAHC-EKVTTEALGVHSIR 66
           | || | .   |. |. |  |..     ||  |..|.|.|||||| .||    || .|. 
Sbjct:  65 SRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLS 124

Query:  67 --QKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
              .   |.|.   |||.| |.   . ||||..||    . ||.|. ... |    |  |
Sbjct: 125 PVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSS--HCPSAG 182

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK-NKDT 183
           | || .||| |         ||  .|..|. .  |   |   | |   | ||| |  .|.
Sbjct: 183 TKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYP--RQIDDTMFCAGDKAGRDS 240

Query: 184 CQGDSGGPLLCNGALVGVTSFG-RGCGR--APGVYAYITEEHLRWIKKTIRTS 233
           ||||||||..|||.| |. |.|   | |   ||||  .  .  .||..||. .
Sbjct: 241 CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLC-KFTKWIQETIQAN 292

>hg18||uc002pvc
        |19|AB259014|Q9UBX7-1|Q9UBX7-1|KLK11|NM_006853|NP_006844|kallikrein 11
        isoform 1 preproprotein

          Length = 250

 Score =  154 bits (388), Expect = 1e-037
 Identities = 91/236 (38%), Positives = 137/236 (58%), Gaps = 17/236 (7%)

Query:  10 SEIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQ 67
           . || | | |||| |.  || .    .|| ||| |.|.|||||| |      || |....
Sbjct:  20 TRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQK 79

Query:  68 KESWQVFR-VTHSIPYPAYN----RKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|  .  |  | | |.| .|     | . ||.|..|. .    |  |. | | |  |   
Sbjct:  80 EEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSS--RCVT 137

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--N 180
            ||||| .||| |.     .   |   |.|...  .|   |  |  ||  |.||  .   
Sbjct: 138 AGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGN--ITDTMVCASVQEGG 195

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIRTS 233
           ||.|||||||||.|| .| |. |.|.      | ||||  .  ... ||..|.. .
Sbjct: 196 KDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVC-KYVDWIQETMKNN 250

>hg18||uc002pvd
        |19|NM_144947|Q9UBX7|KLK11_HUMAN|KLK11|NM_144947|NP_659196|kallikrein
        11 isoform 2 precursor

          Length = 282

 Score =  154 bits (388), Expect = 1e-037
 Identities = 91/236 (38%), Positives = 137/236 (58%), Gaps = 17/236 (7%)

Query:  10 SEIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQ 67
           . || | | |||| |.  || .    .|| ||| |.|.|||||| |      || |....
Sbjct:  52 TRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQK 111

Query:  68 KESWQVFR-VTHSIPYPAYN----RKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|  .  |  | | |.| .|     | . ||.|..|. .    |  |. | | |  |   
Sbjct: 112 EEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSS--RCVT 169

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--N 180
            ||||| .||| |.     .   |   |.|...  .|   |  |  ||  |.||  .   
Sbjct: 170 AGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGN--ITDTMVCASVQEGG 227

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIRTS 233
           ||.|||||||||.|| .| |. |.|.      | ||||  .  ... ||..|.. .
Sbjct: 228 KDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVC-KYVDWIQETMKNN 282

>hg18||uc002pvf
        |19|NM_006853|Q9UBX7-1|Q9UBX7-1|KLK11|NM_006853|NP_006844|kallikrein 11
        isoform 1 preproprotein

          Length = 250

 Score =  154 bits (388), Expect = 1e-037
 Identities = 91/236 (38%), Positives = 137/236 (58%), Gaps = 17/236 (7%)

Query:  10 SEIIGGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVT-TEALGVHSIRQ 67
           . || | | |||| |.  || .    .|| ||| |.|.|||||| |      || |....
Sbjct:  20 TRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQK 79

Query:  68 KESWQVFR-VTHSIPYPAYN----RKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|  .  |  | | |.| .|     | . ||.|..|. .    |  |. | | |  |   
Sbjct:  80 EEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSS--RCVT 137

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--N 180
            ||||| .||| |.     .   |   |.|...  .|   |  |  ||  |.||  .   
Sbjct: 138 AGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGN--ITDTMVCASVQEGG 195

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIRTS 233
           ||.|||||||||.|| .| |. |.|.      | ||||  .  ... ||..|.. .
Sbjct: 196 KDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVC-KYVDWIQETMKNN 250

>hg18||uc002pvn
        |19|NM_015596|Q9UKR3|KLK13_HUMAN|KLK13|NM_015596|NP_056411|kallikrein
        13 precursor

          Length = 277

 Score =  154 bits (387), Expect = 1e-037
 Identities = 95/236 (40%), Positives = 137/236 (58%), Gaps = 16/236 (6%)

Query:  14 GGKEVKPHSMPYM-ALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVHSIRQKESW 71
           ||    ||| |.  ||.     .||| |..|||||||||| |   .  || |.. . |. 
Sbjct:  38 GGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAG 97

Query:  72 -QVFRVTHSIPYPAYNRK----TNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTGTS 126
            ||  | ||||.| | |      .|.|.|.|.|..  . |  .. | | |       ||.
Sbjct:  98 EQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPL-SHNNRLTPGTT 156

Query: 127 CLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDTC 184
           |  .||| |          |   |. .    || . | | . ||  |.|||.|   ||.|
Sbjct: 157 CRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVY-PGK-ITDNMLCAGTKEGGKDSC 214

Query: 185 QGDSGGPLLCNGALVGVTSFGR-GCGR--APGVYAYITEEHLRWIKKTIRTSEMQE 237
           .|||||||.||  | |. |.|   ||.   ||||  ..  .. ||..|||  | |.
Sbjct: 215 EGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVS-RYVLWIRETIRKYETQQ 269

>hg18||uc001wpr
        |14|NM_033423|P20718|GRAH_HUMAN|GZMH|NM_033423|NP_219491|granzyme H

          Length = 246

 Score =  153 bits (386), Expect = 2e-037
 Identities = 93/229 (40%), Positives = 127/229 (55%), Gaps = 12/229 (5%)

Query:  11 EIIGGKEVKPHSMPYMALV----KTATGICGGTLINPKWVLTAAHCEKVTTE-ALGVHSI 65
           ||||| | |||| |||| |    . .   ||| |.   .|||||||.  .    || |.|
Sbjct:  20 EIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNI 79

Query:  66 RQKESWQVF-RVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           ...|  | |  |   ||.|||| |   ||.|.|.||  || |  |. | | | | . | |
Sbjct:  80 KEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPG 139

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKNKD 182
             |  ||||    ..  ..  |  | .||    .| . .  |       || |   | . 
Sbjct: 140 QLCSVAGWGYV--SMSTLATTLQEVLLTVQKDCQCERLFHGN-YSRATEICVGDPKKTQT 196

Query: 183 TCQGDSGGPLLCNGALVGVTSFGRGCGRAPGVYAYITEEHLRWIKKTIR 231
             .|||||||.|     |. |.|   |  ||||  ..   | |||.|..
Sbjct: 197 GFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVS-HFLPWIKRTMK 244

>hg18||uc001wps
        |14|NM_004131|P10144|GRAB_HUMAN|GZMB|NM_004131|NP_004122|granzyme B
        precursor

          Length = 247

 Score =  153 bits (385), Expect = 2e-037
 Identities = 96/233 (41%), Positives = 128/233 (54%), Gaps = 19/233 (8%)

Query:  11 EIIGGKEVKPHSMPYMALV----KTATGICGGTLINPKWVLTAAHC-EKVTTEALGVHSI 65
           ||||| | |||| |||| .    . .   ||| ||   .|||||||        || |.|
Sbjct:  20 EIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIQDDFVLTAAHCWGSSINVTLGAHNI 79

Query:  66 RQKESWQVF-RVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           ...|  | |  |   ||.|||| |   ||.|.|.||  ||.|. |. | | | | . | |
Sbjct:  80 KEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPG 139

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSK----YYSPNRVITKAMICAGSK- 179
            .|  ||||||    |  |  |  | .|| .  .|      ||      .   .| |   
Sbjct: 140 QTCSVAGWGQTAPLGKH-SHTLQEVKMTVQEDRKCESDLRHYYD-----STIELCVGDPE 193

Query: 180 -NKDTCQGDSGGPLLCNGALVGVTSFGRGCGRAPGVYAYITEEHLRWIKKTIR 231
             | . .|||||||.||    |. |.||  |  |     ..   . |||||..
Sbjct: 194 IKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVS-SFVHWIKKTMK 245

>hg18||uc003wal
        |7|BC103998|Q3SY20|Q3SY20_HUMAN|PRSS2|NM_002770|NP_002761|protease,
        serine, 2 preproprotein

          Length = 247

 Score =  149 bits (376), Expect = 3e-036
 Identities = 86/232 (37%), Positives = 126/232 (54%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . .    |||.||| .||..| || |   .  || |
Sbjct:  17 PFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEH 76

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|   | . |       | .| || .| |||....|| . |     |  . |  |   | 
Sbjct:  77 NIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISL--PTAPPA 134

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
            ||  | .||| |  .  .  | |  ..  |. . ||   | | . ||  | | |     
Sbjct: 135 AGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASY-PGK-ITNNMFCVGFLEGG 192

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCGR--APGVYAYITEEHLRWIKKTI 230
           ||.||||||||.. || | |. |.| || .   ||||  .   .. ||| ||
Sbjct: 193 KDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKV-YNYVDWIKDTI 243

>hg18||uc002pvs
        |19|NM_022046|Q9P0G3|KLK14_HUMAN|KLK14|NM_022046|NP_071329|kallikrein
        14 preproprotein

          Length = 267

 Score =  148 bits (371), Expect = 1e-035
 Identities = 88/232 (37%), Positives = 131/232 (56%), Gaps = 15/232 (6%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG---ICGGTLINPKWVLTAAHCEK-VTTEALGVHSI 65
           ..||||      | |. | .        .||| |.. .||.||||| . .   ||| |..
Sbjct:  39 NKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNL 98

Query:  66 RQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           |. | . || ||   . .| || .|.|||||.|.|.  |.  . |. . .      |  |
Sbjct:  99 RRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASP--G 156

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKNKD 182
           |||  .|||  .  .      |  ||. .     | | |   | ||  |.|||     ||
Sbjct: 157 TSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYP--RTITPGMVCAGVPQGGKD 214

Query: 183 TCQGDSGGPLLCNGALVGVTSFG-RGCGRA--PGVYAYITEEHLRWIKKTIR 231
           .|||||||||.| | | |. |.|   |     ||||  .  ..  ||..|.|
Sbjct: 215 SCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLC-KYRSWIEETMR 265

>hg18||uc003wap
        |7|NM_002770|P07478|TRY2_HUMAN|PRSS2|NM_002770|NP_002761|protease,
        serine, 2 preproprotein

          Length = 247

 Score =  146 bits (368), Expect = 2e-035
 Identities = 85/232 (36%), Positives = 126/232 (54%), Gaps = 11/232 (4%)

Query:   5 PYSHGSEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHCEKVTTEA-LGVH 63
           |.    .|.||   . .|.||   . .    |||.||. .||..| || |   .  || |
Sbjct:  17 PFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEH 76

Query:  64 SIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|   | . |       | .| || .| |||....|| . |     |  . |  |   | 
Sbjct:  77 NIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISL--PTAPPA 134

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
            ||  | .||| |  .  .  | |  ..  |. . ||   | | . ||  | | |     
Sbjct: 135 AGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASY-PGK-ITNNMFCVGFLEGG 192

Query: 181 KDTCQGDSGGPLLCNGALVGVTSFGRGCGR--APGVYAYITEEHLRWIKKTI 230
           ||.||||||||.. || | |. |.| || .   ||||  .   .. ||| ||
Sbjct: 193 KDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKV-YNYVDWIKDTI 243

>hg18||uc002lqc
        |19|NM_001928|Q5U5S1|Q5U5S1_HUMAN|CFD|NM_001928|NP_001919|complement
        factor D preproprotein

          Length = 253

 Score =  145 bits (365), Expect = 5e-035
 Identities = 86/229 (37%), Positives = 128/229 (55%), Gaps = 12/229 (5%)

Query:  12 IIGGKEVKPHSMPYMALVK-TATGICGGTLINPKWVLTAAHCEKVTTEA-----LGVHSI 65
           |.||.| . |. |||| |.     .||| |.  .|||.|||| .   .      || ||.
Sbjct:  26 ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSL 85

Query:  66 RQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
            | | | ... |  ..|.|     | |.||..|.|   |     |. |      |.   |
Sbjct:  86 SQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPG 145

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKNKDTC 184
           | |  ||||  | | .   | |  | . |.||  |..    .  ||. ..|| |  .|.|
Sbjct: 146 TLCDVAGWGIVNHAGRR-PDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSC 204

Query: 185 QGDSGGPLLCNGALVG-VTSFGRGCG--RAPGVYAYITEEHLRWIKKTI 230
           .|||||||.| | | | |||  | ||  . ||.|  .   .  ||   .
Sbjct: 205 KGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVA-SYAAWIDSVL 252

>hg18||uc001wpp |14|NM_001836|P23946|CMA1_HUMAN|CMA1|NM_001836|NP_001827|chymase
        1, mast cell preproprotein

          Length = 247

 Score =  143 bits (360), Expect = 2e-034
 Identities = 90/235 (38%), Positives = 122/235 (51%), Gaps = 16/235 (6%)

Query:   7 SHGSEIIGGKEVKPHSMPYMALVKTATG-----ICGGTLINPKWVLTAAHCE-KVTTEAL 60
           .   ||||| | |||| |||| ..  |       ||| ||   .|||||||  .  |  |
Sbjct:  17 AEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTL 76

Query:  61 GVHSIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKR 119
           | |.| ..| .||   |     .| ||  |  .|.|.|||.  |  |  |  |   |   
Sbjct:  77 GAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFN 136

Query: 120 EPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGS- 178
               |  |  ||||.|   .|  || |  | . ..|   || .   .       .| |. 
Sbjct: 137 FVPPGRMCRVAGWGRTG-VLKPGSDTLQEVKLRLMDPQACSHFRDFDH---NLQLCVGNP 192

Query: 179 -KNKDTCQGDSGGPLLCNGALVGVTSFGRGCGRAPGVYAYITEEHLR-WIKKTIR 231
            | |   .||||||||| |   |. |.||   . | |.  |.  | | || . ..
Sbjct: 193 RKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRIS--HYRPWINQILQ 245

>hg18||uc001wpq
        |14|NM_001911|P08311|CATG_HUMAN|CTSG|NM_001911|NP_001902|cathepsin G
        preproprotein

          Length = 255

 Score =  138 bits (347), Expect = 6e-033
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 19/240 (7%)

Query:   7 SHGSEIIGGKEVKPHSMPYMALVK----TATGICGGTLINPKWVLTAAHC-EKVTTEALG 61
           .   |||||.| .||| |||| ..         ||| |.   .|||||||        ||
Sbjct:  16 AEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLG 75

Query:  62 VHSIRQKESWQV-FRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKRE 120
            |.|...|. |       .| .| ||..|  ||.|.|.|    .. .||  . |   .  
Sbjct:  76 AHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEG 135

Query: 121 PKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKY---YSPNRVITKAMICAG 177
            . || |  ||||.   ...  .| |  | . |    .| .    | | |      || |
Sbjct: 136 LRPGTLCTVAGWGRV--SMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRR-----QICVG 188

Query: 178 SK--NKDTCQGDSGGPLLCNGALVGVTSFGRGCGRAPGVYAYITEEHLRWIKKTIRTSEM 235
            .   |   .||||||||||    |. |.|.  |  | |.  ..   | ||. |.|. ..
Sbjct: 189 DRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVS-SFLPWIRTTMRSFKL 247

>hg18||uc002puh
        |19|DQ223012|Q6H301|Q6H301_HUMAN|KLK6|NM_002774|NP_002765|kallikrein-re
        lated peptidase 6 isoform A

          Length = 253

 Score =  138 bits (346), Expect = 8e-033
 Identities = 87/231 (37%), Positives = 132/231 (57%), Gaps = 17/231 (7%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG-ICGGTLINPKWVLTAAHCEKVTTEA-LGVHSIRQ 67
           .... |      | || | . |.   .||| ||.| ||||||||.|   .  || |..||
Sbjct:  29 NKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQ 88

Query:  68 KESWQ-VFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG-T 125
           .|| |    |  .. .| |.  ..| |.|.|.|   || .. .. | |   .|.     |
Sbjct:  89 RESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPL---ERDCSANTT 145

Query: 126 SCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDT 183
           ||   |||.| .   .  | .    . .| | ||   |     ||. |.||| .   ||.
Sbjct: 146 SCHILGWGKTADG--DFPDTIQCAYIHLVSREECEHAYPGQ--ITQNMLCAGDEKYGKDS 201

Query: 184 CQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIR 231
           |||||||||.|   | |. |.|    |    ||||  .   .  ||.|||.
Sbjct: 202 CQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVC-RYTNWIQKTIQ 251

>hg18||uc002pui
        |19|NM_001012964|Q92876|KLK6_HUMAN|KLK6|NM_001012964|NP_001012982|kalli
        krein-related peptidase 6 isoform A

          Length = 244

 Score =  138 bits (346), Expect = 8e-033
 Identities = 87/231 (37%), Positives = 132/231 (57%), Gaps = 17/231 (7%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG-ICGGTLINPKWVLTAAHCEKVTTEA-LGVHSIRQ 67
           .... |      | || | . |.   .||| ||.| ||||||||.|   .  || |..||
Sbjct:  20 NKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQ 79

Query:  68 KESWQ-VFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG-T 125
           .|| |    |  .. .| |.  ..| |.|.|.|   || .. .. | |   .|.     |
Sbjct:  80 RESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPL---ERDCSANTT 136

Query: 126 SCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDT 183
           ||   |||.| .   .  | .    . .| | ||   |     ||. |.||| .   ||.
Sbjct: 137 SCHILGWGKTADG--DFPDTIQCAYIHLVSREECEHAYPGQ--ITQNMLCAGDEKYGKDS 192

Query: 184 CQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIR 231
           |||||||||.|   | |. |.|    |    ||||  .   .  ||.|||.
Sbjct: 193 CQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVC-RYTNWIQKTIQ 242

>hg18||uc002pul
        |19|NM_002774|Q92876|KLK6_HUMAN|KLK6|NM_002774|NP_002765|kallikrein-rel
        ated peptidase 6 isoform A

          Length = 244

 Score =  138 bits (346), Expect = 8e-033
 Identities = 87/231 (37%), Positives = 132/231 (57%), Gaps = 17/231 (7%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG-ICGGTLINPKWVLTAAHCEKVTTEA-LGVHSIRQ 67
           .... |      | || | . |.   .||| ||.| ||||||||.|   .  || |..||
Sbjct:  20 NKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQ 79

Query:  68 KESWQ-VFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG-T 125
           .|| |    |  .. .| |.  ..| |.|.|.|   || .. .. | |   .|.     |
Sbjct:  80 RESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPL---ERDCSANTT 136

Query: 126 SCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDT 183
           ||   |||.| .   .  | .    . .| | ||   |     ||. |.||| .   ||.
Sbjct: 137 SCHILGWGKTADG--DFPDTIQCAYIHLVSREECEHAYPGQ--ITQNMLCAGDEKYGKDS 192

Query: 184 CQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKTIR 231
           |||||||||.|   | |. |.|    |    ||||  .   .  ||.|||.
Sbjct: 193 CQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVC-RYTNWIQKTIQ 242

>hg18||uc002fds
        |16|NM_001906|Q6GPI1|Q6GPI1_HUMAN|CTRB1|NM_001906|NP_001897|chymotrypsi
        nogen B1

          Length = 263

 Score =  135 bits (339), Expect = 5e-032
 Identities = 84/232 (36%), Positives = 128/232 (55%), Gaps = 14/232 (6%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG--ICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQ 67
           | |. |..  | | |.   ..  ||   |||.||.  ||.|||||   |.. .      |
Sbjct:  32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQ 91

Query:  68 ---KESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
              .|. || ..      | ..  | .||. .||| | |. .. |  . | |   .   |
Sbjct:  92 GSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAG 151

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKNKDTC 184
           | | | |||.|     .  | |    . ..   || |  |  | ||  |||||.    .|
Sbjct: 152 TLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKK--SWGRRITDVMICAGASGVSSC 209

Query: 185 QGDSGGPLLC--NGA--LVGVTSFGRG-CG-RAPGVYAYITEEHLRWIKKTI 230
            |||||||.|  .||  |||. |.|   |   .||||| .| . . |..| .
Sbjct: 210 MGDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVT-KLIPWVQKIL 260

>hg18||uc002puo |19|NM_139277|P49862|KLK7_HUMAN|KLK7|NM_139277|NP_644806|stratum
        corneum chymotryptic enzyme

          Length = 253

 Score =  135 bits (339), Expect = 5e-032
 Identities = 81/232 (34%), Positives = 127/232 (54%), Gaps = 13/232 (5%)

Query:   7 SHGSEIIGGKEVKPHSMPYMALVKTATGI-CGGTLINPKWVLTAAHCE-KVTTEALGVHS 64
           . | .|| |      | |.   . .   . ||| |.| .||||||||.    |  ||  .
Sbjct:  25 AQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDT 84

Query:  65 IRQKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           .  . . |  . . |  .| |. .|. ||||..|| . |. .  || . |  | |    |
Sbjct:  85 LGDRRA-QRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRL--PSRCEPPG 141

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKNKD 182
           |.|  .||| |          || |.| ..   .|.| |    ..  .|.|||     |.
Sbjct: 142 TTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKD--LLENSMLCAGIPDSKKN 199

Query: 183 TCQGDSGGPLLCNGALVGVTSFGR-GCGRA--PGVYAYITEEHLRWIKKTIR 231
            | |||||||.| | | |. |.|   ||.   ||||  .  .  .||  |..
Sbjct: 200 ACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVC-KFTKWINDTMK 250

>hg18||uc002pup |19|NM_005046|P49862|KLK7_HUMAN|KLK7|NM_005046|NP_005037|stratum
        corneum chymotryptic enzyme

          Length = 253

 Score =  135 bits (339), Expect = 5e-032
 Identities = 81/232 (34%), Positives = 127/232 (54%), Gaps = 13/232 (5%)

Query:   7 SHGSEIIGGKEVKPHSMPYMALVKTATGI-CGGTLINPKWVLTAAHCE-KVTTEALGVHS 64
           . | .|| |      | |.   . .   . ||| |.| .||||||||.    |  ||  .
Sbjct:  25 AQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDT 84

Query:  65 IRQKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
           .  . . |  . . |  .| |. .|. ||||..|| . |. .  || . |  | |    |
Sbjct:  85 LGDRRA-QRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRL--PSRCEPPG 141

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKNKD 182
           |.|  .||| |          || |.| ..   .|.| |    ..  .|.|||     |.
Sbjct: 142 TTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKD--LLENSMLCAGIPDSKKN 199

Query: 183 TCQGDSGGPLLCNGALVGVTSFGR-GCGRA--PGVYAYITEEHLRWIKKTIR 231
            | |||||||.| | | |. |.|   ||.   ||||  .  .  .||  |..
Sbjct: 200 ACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVC-KFTKWINDTMK 250

>hg18||uc002low
        |19|NM_005317|P51124|GRAM_HUMAN|GZMM|NM_005317|NP_005308|granzyme M
        precursor

          Length = 257

 Score =  134 bits (335), Expect = 1e-031
 Identities = 88/235 (37%), Positives = 132/235 (56%), Gaps = 17/235 (7%)

Query:   7 SHGSEIIGGKEVKPHSMPYMA-LVKTATGICGGTLINPKWVLTAAHCEKVTTE----ALG 61
           | |..||||.|| ||| |||| | .  . .||| |..||||||||||           ||
Sbjct:  21 SFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLG 80

Query:  62 VHSIRQKESWQVFRVTHSIPYPAYNR-KTNDNDLMILKLETAAKQTKNVKYLHLGSPKRE 120
           .|..        | .  .| .| |      .||| .|.|.   | .. .. | | | .. 
Sbjct:  81 LHTL--DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQV 138

Query: 121 PKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMIC--AGS 178
              || |  |||| |..  . .| ||  ... |.|   |.     |  .. .|.|  | |
Sbjct: 139 VAAGTRCSMAGWGLTHQGGR-LSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADS 197

Query: 179 KNKDTCQGDSGGPLLC--NGALVGVTSF-GRGCGR--APGVYAYITEEHLRWIKK 228
           |..  |.|||||||.|     | || ||  | |     | | |     .. ||.|
Sbjct: 198 KDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPV-ATAVAPYVSWIRK 251

>hg18||uc002fdr
        |16|NM_001025200|P17538|CTRB1_HUMAN|CTRB2|NM_001025200|NP_001020371|chy
        motrypsinogen B2

          Length = 263

 Score =  132 bits (332), Expect = 3e-031
 Identities = 83/232 (35%), Positives = 126/232 (54%), Gaps = 14/232 (6%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATG--ICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQ 67
           | |. |..  | | |.   ..  ||   |||.||.  ||.|||||   |.. .      |
Sbjct:  32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQ 91

Query:  68 ---KESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTG 124
              .|. || ..      | ..  | .||. .||| | |. .. |  . | |   .   |
Sbjct:  92 GSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAG 151

Query: 125 TSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKNKDTC 184
           | | | |||.|     .  | |    . ..   || |  |  | ||  |||||.    .|
Sbjct: 152 TLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKK--SWGRRITDVMICAGASGVSSC 209

Query: 185 QGDSGGPLLC--NGA--LVGVTSFG-RGCG-RAPGVYAYITEEHLRWIKKTI 230
            |||||||.|  .||  |||. |.| | |    | ||| .  . . |..| .
Sbjct: 210 MGDSGGPLVCQKDGAWTLVGIVSWGSRTCSTTTPAVYARVA-KLIPWVQKIL 260

>hg18||uc002euw
        |16|NM_001907|P40313|CTRL_HUMAN|CTRL|NM_001907|NP_001898|chymotrypsin-l
        ike

          Length = 264

 Score =  124 bits (310), Expect = 1e-028
 Identities = 78/236 (33%), Positives = 122/236 (51%), Gaps = 15/236 (6%)

Query:   7 SHGSEIIGGKEVKPHSMPYMALVKTATG--ICGGTLINPKWVLTAAHCEKVTTE---ALG 61
           |    |. |.     | |.   .. ..|   |||.||.  ||.|||||          ||
Sbjct:  29 SFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLG 88

Query:  62 VHS-IRQKESWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKRE 120
            .      |  ||  |. .| .|..|  | .||. .||| . |. |  .  . | |    
Sbjct:  89 EYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEA 148

Query: 121 PKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKN 180
              | .|.| |||. .         |  | . .|   .| .|.  .  || .|||||   
Sbjct: 149 LTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSS--ITDSMICAGGAG 206

Query: 181 KDTCQGDSGGPLLC----NGALVGVTSFG-RGCG-RAPGVYAYITEEHLRWIKKTI 230
             .|||||||||.|       |.|. |.| . |  ||| ||  .. .   || . |
Sbjct: 207 ASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVS-KFSTWINQVI 261

>hg18||uc003wam |7|BC035777|NA|NA|PRSS1|NM_002769|NP_002760|protease, serine, 1
        preproprotein

          Length = 187

 Score =  121 bits (301), Expect = 1e-027
 Identities = 71/176 (40%), Positives = 99/176 (56%), Gaps = 10/176 (5%)

Query:  60 LGVHSIRQKE-SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPK 118
           || |.|   | . |       | .| |.||| .||.|..|| . |     |  . |  | 
Sbjct:  13 LGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISL--PT 70

Query: 119 REPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG- 177
             | ||| || .||| |  .  .  | |  ..  |. . .|   | | . ||  | | | 
Sbjct:  71 APPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASY-PGK-ITSNMFCVGF 128

Query: 178 -SKNKDTCQGDSGGPLLCNGALVGVTSFGRGCGR--APGVYAYITEEHLRWIKKTI 230
               ||.||||||||..||| | || |.| || .   ||||  .   ...||| ||
Sbjct: 129 LEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKV-YNYVKWIKNTI 183

>hg18||uc001prs
        |11|NM_001077263|Q1RMF8|Q1RMF8_HUMAN|TMPRSS13|NM_001077263|NP_001070731
        |transmembrane protease, serine 13

          Length = 567

 Score =  119 bits (297), Expect = 4e-027
 Identities = 79/231 (34%), Positives = 116/231 (50%), Gaps = 29/231 (12%)

Query:  12 IIGGKEVKPHSMPY-MALVKTATGICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQKES 70
           |.||        |. ..|    | |||||||. .||||||||  || |       .  | 
Sbjct: 326 IVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTRE-------KVLEG 378

Query:  71 WQVFRVT---HSIPYPA----------YNRKTNDNDLMILKLETAAKQTKNVKYLHLGSP 117
           |.|.  |   | .|  |          |  . .| |. ...|      . ..    |   
Sbjct: 379 WKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMH 438

Query: 118 KREPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG 177
            .      .|   |.|.| |   . |  |  | | ..|  .|. |   .  .|  |.|||
Sbjct: 439 GQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAG 498

Query: 178 S--KNKDTCQGDSGGPLLC----NGALVGVTSFGRGCGR--APGVYAYITE 220
                .|.|||||||||.|       | ||||.| |||.   ||||  .||
Sbjct: 499 DLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTE 549

>hg18||uc001prt |11|AB048796|Q9BYE2|TMPSD_HUMAN|TMPRSS13|NA|NA|Transmembrane
        protease, serine 13 (EC 3.4.21.-) (Mosaic serine protease)
        (Membrane-type mosaic serine protease)

          Length = 265

 Score =  119 bits (297), Expect = 4e-027
 Identities = 79/231 (34%), Positives = 116/231 (50%), Gaps = 29/231 (12%)

Query:  12 IIGGKEVKPHSMPY-MALVKTATGICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQKES 70
           |.||        |. ..|    | |||||||. .||||||||  || |       .  | 
Sbjct:   5 IVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTRE-------KVLEG 57

Query:  71 WQVFRVT---HSIPYPA----------YNRKTNDNDLMILKLETAAKQTKNVKYLHLGSP 117
           |.|.  |   | .|  |          |  . .| |. ...|      . ..    |   
Sbjct:  58 WKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMH 117

Query: 118 KREPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG 177
            .      .|   |.|.| |   . |  |  | | ..|  .|. |   .  .|  |.|||
Sbjct: 118 GQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAG 177

Query: 178 S--KNKDTCQGDSGGPLLC----NGALVGVTSFGRGCGR--APGVYAYITE 220
                .|.|||||||||.|       | ||||.| |||.   ||||  .||
Sbjct: 178 DLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTE 228

>hg18||uc001rix
        |12|NM_183378|Q7RTY7|OVCH1_HUMAN|OVCH1|NM_183378|NP_899234|ovochymase
        1

          Length = 1134

 Score =  115 bits (287), Expect = 5e-026
 Identities = 82/227 (36%), Positives = 117/227 (51%), Gaps = 21/227 (9%)

Query:  12 IIGGKEVKPHSMPYMALVKTATGI-CGGTLINPKWVLTAAHCEKVTTEAL------GVHS 64
           | ||.|  ||  |.   ..      ||| .||| |.|||||| ..    |      | | 
Sbjct: 575 IAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLSWTIIAGDHD 634

Query:  65 IRQKESW-QVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKT 123
              |||  || |  | | .  .|  . |.|. ...| .  .    |. . |        .
Sbjct: 635 RNLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFS 694

Query: 124 GTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECS-KYYSPN-RVITKAMICAG---S 178
              |   |||  . |   ..  |  . | |..|  |   ||| .   ||. |||||   |
Sbjct: 695 SEICAVTGWGSIS-ADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAAS 753

Query: 179 KNKDTCQGDSGGPLLC---NG--ALVGVTSFGRGCGR--APGVYAYI 218
             || |||||||||.|   ||   | |. |.| || .   |||.| .
Sbjct: 754 GEKDFCQGDSGGPLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARV 800

>hg18||uc002pub
        |19|AY923170|Q9Y5K2|KLK4_HUMAN|KLK4|NM_004917|NP_004908|kallikrein-rela
        ted peptidase 4 preproprotein

          Length = 159

 Score =  115 bits (286), Expect = 7e-026
 Identities = 66/160 (41%), Positives = 94/160 (58%), Gaps = 12/160 (7%)

Query:  79 SIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPKTGTSCLTAGWGQTNEA 138
           |. .| |||    ||||..||. .  ..  .. . . |  . |  | ||| .|||    |
Sbjct:   7 SVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIAS--QCPTAGNSCLVSGWGLL--A 62

Query: 139 VKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGS--KNKDTCQGDSGGPLLCNG 196
              .  ||  |||.||    ||| | |  .   .| |||     ||.| |||||||.|||
Sbjct:  63 NGRMPTVLQCVNVSVVSEEVCSKLYDP--LYHPSMFCAGGGHDQKDSCNGDSGGPLICNG 120

Query: 197 ALVGVTSFGRG-CGR--APGVYAYITEEHLRWIKKTIRTS 233
            | |. |||.  ||.   ||||  .  .   ||.||.. |
Sbjct: 121 YLQGLVSFGKAPCGQVGVPGVYTNLC-KFTEWIEKTVQAS 159

>hg18||uc002pvb
        |19|AB261897|Q8IXD7|Q8IXD7_HUMAN|KLK11|NM_006853|NP_006844|kallikrein
        11 isoform 1 preproprotein

          Length = 275

 Score =  115 bits (286), Expect = 7e-026
 Identities = 66/184 (35%), Positives = 106/184 (57%), Gaps = 15/184 (8%)

Query:  60 LGVHSIRQKESWQVFR-VTHSIPYPAYN----RKTNDNDLMILKLETAAKQTKNVKYLHL 114
           || |.....|  .  |  | | |.| .|     | . ||.|..|. .    |  |. | |
Sbjct:  97 LGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTL 156

Query: 115 GSPKREPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMI 174
            |  |    ||||| .||| |.     .   |   |.|...  .|   |  |  ||  |.
Sbjct: 157 SS--RCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGN--ITDTMV 212

Query: 175 CAGSK--NKDTCQGDSGGPLLCNGALVGVTSFGR---GCGRAPGVYAYITEEHLRWIKKT 229
           ||  .   ||.|||||||||.|| .| |. |.|.      | ||||  .  ... ||..|
Sbjct: 213 CASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVC-KYVDWIQET 271

Query: 230 IRTS 233
           .. .
Sbjct: 272 MKNN 275

>hg18||uc002lpz
        |19|NM_001700|P20160|CAP7_HUMAN|AZU1|NM_001700|NP_001691|azurocidin 1
        preproprotein

          Length = 251

 Score =  114 bits (285), Expect = 9e-026
 Identities = 75/217 (34%), Positives = 111/217 (51%), Gaps = 19/217 (8%)

Query:  11 EIIGGKEVKPHSMPYMALVKT-ATGICGGTLINPKWVLTAAHCEK-----VTTEALGVHS 64
           .|.||.. .|   |..| ..      ||| ||. ..|.||| | .     |.|  || . 
Sbjct:  26 DIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYD 85

Query:  65 IRQKE--SWQVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|..|  | | | .. |.    |. . | ||||.|.|.  |  | .|  | |       .
Sbjct:  86 LRRRERQSRQTFSIS-SMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVE 144

Query: 123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKNKD 182
            || |  ||||      . .|     |||||    .|     || | |  .   |     
Sbjct: 145 AGTRCQVAGWGSQRSGGR-LSRFPRFVNVTVTPEDQC----RPNNVCTGVLTRRGG---- 195

Query: 183 TCQGDSGGPLLCNGALVGVTSFGRG-CGRAPGVYAYI 218
            | || | ||.| |   || ||  | ||| |  .  .
Sbjct: 196 ICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRV 232

>hg18||uc001lai
        |10|NM_004132|Q14520|HABP2_HUMAN|HABP2|NM_004132|NP_004123|hyaluronan
        binding protein 2

          Length = 560

 Score =  113 bits (282), Expect = 2e-025
 Identities = 77/208 (37%), Positives = 108/208 (51%), Gaps = 23/208 (11%)

Query:  36 CGGTLINPKWVLTAAHCEKVTTE----ALGVHSIRQKE-SWQVFRVTHSIPYPAYNRKTN 90
           ||| ||.| ||||||||  . |      ||   ....|   | |||     |  || .  
Sbjct: 347 CGGALIHPCWVLTAAHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDE 406

Query:  91 --DNDLMILKLET----AAKQTKNVKYLHLGSPKREPKTGTSCLTAGWGQTNEAVKEISD 144
              ||. .|||.      | ..| || . |  |     .|. |  .||| |     . | 
Sbjct: 407 IPHNDIALLKLKPVDGHCALESKYVKTVCL--PDGSFPSGSECHISGWGVTETG--KGSR 462

Query: 145 VLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSKNK---DTCQGDSGGPLLCNG----A 197
            |.   | ..    |.     . .|  .|||||.  |   ||||||||||| |       
Sbjct: 463 QLLDAKVKLIANTLCNSRQLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYY 522

Query: 198 LVGVTSFGRGCGRAPGVYAYITEEHLRW 225
           . |. |.|  ||. ||||  .| . | |
Sbjct: 523 VYGIVSWGLECGKRPGVYTQVT-KFLNW 549

>hg18||uc003ghc |4|NM_001528|Q04756|HGFA_HUMAN|HGFAC|NM_001528|NP_001519|HGF
        activator preproprotein

          Length = 655

 Score =  113 bits (282), Expect = 2e-025
 Identities = 79/227 (34%), Positives = 111/227 (48%), Gaps = 20/227 (8%)

Query:  12 IIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHC------EKVTTEALGVHSI 65
           ||||    | | |..| .      | |.|..  ||..||||          .  || |  
Sbjct: 408 IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFF 467

Query:  66 -RQKESWQVFRVTHSIPYPAYN-RKTNDNDLMILKL----ETAAKQTKNVKYLHLGSPKR 119
            |  .  | | .   |||  |.    .|.||....|    .  | ... |. . |  |  
Sbjct: 468 NRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGS 527

Query: 120 EPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG-- 177
               |  |  ||||  .| |   |  |    | .|   .||        |.  |.|||  
Sbjct: 528 TFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYF 587

Query: 178 SKNKDTCQGDSGGPLLC--NGA--LVGVTSFGRGCGR--APGVYAYI 218
               | ||||||||| |  ||   | |. |.| ||||   ||||  .
Sbjct: 588 DCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRV 634

>hg18||uc003qtl
        |6|NM_005577|Q5VTD7|Q5VTD7_HUMAN|LPA|NM_005577|NP_005568|lipoprotein
        Lp(a) precursor

          Length = 2040

 Score =  111 bits (275), Expect = 1e-024
 Identities = 83/233 (35%), Positives = 110/233 (47%), Gaps = 35/233 (15%)

Query:   12 IIGGKEVKPHSMPYMALVKTATG--ICGGTLINPKWVLTAAHCEKVTTE------ALGVH 63
            |.||    ||| |.   ..|  |   ||||||.|.|||||||| | ..        || |
Sbjct: 1820 IVGGCVAHPHSWPWQVSLRTRFGKHFCGGTLISPEWVLTAAHCLKKSSRPSSYKVILGAH 1879

Query:   64 SIRQKESW-QVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
                 ||  |   |.     |         |. .|||   |  |  |    | ||     
Sbjct: 1880 QEVNLESHVQEIEVSRLFLEP------TQADIALLKLSRPAVITDKVMPACLPSPDYMVT 1933

Query:  123 TGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG--SKN 180
              | |   |||.|       . .|    . |..   |. |           |||   .. 
Sbjct: 1934 ARTECYITGWGETQGTFG--TGLLKEAQLLVIENEVCNHY---------KYICAEHLARG 1982

Query:  181 KDTCQGDSGGPLLC----NGALVGVTSFGRGCGR--APGVYAYITEEHLRWIK 227
             |.|||||||||.|       | ||||.| || |   ||||| ..   . ||.
Sbjct: 1983 TDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVS-RFVTWIE 2034

>hg18||uc002cky |16|NM_024164|NA|NA|TPSB2|NM_024164|NP_077078|tryptase beta 2
        precursor

          Length = 275

 Score =  108 bits (268), Expect = 9e-024
 Identities = 73/238 (30%), Positives = 112/238 (47%), Gaps = 24/238 (10%)

Query:  12 IIGGKEVKPHSMPYMALVKTA----TGICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQ 67
           |.||.|      |.   ..         |||.||.|.||||||||     . |    .. 
Sbjct:  31 IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQL 90

Query:  68 KESW-----QVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|       |.  |.  | .| .       |. .|.||     . .|  . |        
Sbjct:  91 REQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFP 150

Query: 123 TGTSCLTAGWGQT-NEAVKEISDVLMSVNVTVVDRMECSKYY-------SPNRVITKAMI 174
            |  |   |||   |.        |  | | ...   |   |          |..   |.
Sbjct: 151 PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML 210

Query: 175 CAGSKNKDTCQGDSGGPLLC--NGALV--GVTSFGRGCGR--APGVYAYITEEHLRWI 226
           |||.  .|.|||||||||.|  ||  .  || |.| || .   ||.|  .|  .| ||
Sbjct: 211 CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVT-YYLDWI 267

>hg18||uc002ckz
        |16|NM_003294|Q15661|TRYB1_HUMAN|TPSAB1|NM_003294|NP_003285|tryptase
        alpha/beta 1 precursor

          Length = 275

 Score =  107 bits (267), Expect = 1e-023
 Identities = 73/238 (30%), Positives = 112/238 (47%), Gaps = 24/238 (10%)

Query:  12 IIGGKEVKPHSMPYMALVKTA----TGICGGTLINPKWVLTAAHCEKVTTEALGVHSIRQ 67
           |.||.|      |.   ..         |||.||.|.||||||||     . |    .. 
Sbjct:  31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQL 90

Query:  68 KESW-----QVFRVTHSIPYPAYNRKTNDNDLMILKLETAAKQTKNVKYLHLGSPKREPK 122
           .|       |.  |.  | .| .       |. .|.||     . .|  . |        
Sbjct:  91 REQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFP 150

Query: 123 TGTSCLTAGWGQT-NEAVKEISDVLMSVNVTVVDRMECSKYY-------SPNRVITKAMI 174
            |  |   |||   |.        |  | | ...   |   |          |..   |.
Sbjct: 151 PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDML 210

Query: 175 CAGSKNKDTCQGDSGGPLLC--NGALV--GVTSFGRGCGR--APGVYAYITEEHLRWI 226
           |||.  .|.|||||||||.|  ||  .  || |.| || .   ||.|  .|  .| ||
Sbjct: 211 CAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVT-YYLDWI 267

>hg18||uc002cla
        |16|AF206667|Q15661-2|Q15661-2|TPSAB1|NM_003294|NP_003285|tryptase
        alpha/beta 1 precursor

          Length = 211

 Score =  102 bits (254), Expect = 4e-022
 Identities = 68/208 (32%), Positives = 103/208 (49%), Gaps = 25/208 (12%)

Query:  36 CGGTLINPKWVLTAAHCEKVTTEALGVHSIRQKESW---QVFRVTHSIPYPAYNRKTNDN 92
           |||.||.|.||||||||       .|   .|..  .   |.  |.  | .| .       
Sbjct:   4 CGGSLIHPQWVLTAAHC-------VGPVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA 56

Query:  93 DLMILKLETAAKQTKNVKYLHLGSPKREPKTGTSCLTAGWGQT-NEAVKEISDVLMSVNV 151
           |. .|.||     . .|  . |         |  |   |||   |.        |  | |
Sbjct:  57 DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV 116

Query: 152 TVVDRMECSKYY-------SPNRVITKAMICAGSKNKDTCQGDSGGPLLC--NGALV--G 200
            ...   |   |          |..   |.|||.  .|.|||||||||.|  ||  .  |
Sbjct: 117 PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG 176

Query: 201 VTSFGRGCGR--APGVYAYITEEHLRWI 226
           | |.| || .   ||.|  .|  .| ||
Sbjct: 177 VVSWGEGCAQPNRPGIYTRVT-YYLDWI 203

>hg18||uc001jwa
        |10|NM_002658|Q5SWW9|Q5SWW9_HUMAN|PLAU|NM_002658|NP_002649|urokinase
        plasminogen activator preproprotein

          Length = 431

 Score =  101 bits (250), Expect = 1e-021
 Identities = 67/218 (30%), Positives = 111/218 (50%), Gaps = 22/218 (10%)

Query:  31 TATGICGGTLINPKWVLTAAHC------EKVTTEALGVHSIRQKESWQV-FRVTHSIPYP 83
           . | .|||.||.| ||..| ||      ..     ||   .      .. | | . | . 
Sbjct: 204 SVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHK 263

Query:  84 AYNRKT--NDNDLMILKLET----AAKQTKNVKYLHLGSPKREPKTGTSCLTAGWGQTNE 137
            |.  |  . ||. .||. .     |. .. .. . | |   .|. ||||   |.|. | 
Sbjct: 264 DYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENS 323

Query: 138 AVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDTCQGDSGGPLLCN 195
                 . |    | ..   || . .     .|  |.||       |.|||||||||.|.
Sbjct: 324 TDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCS 383

Query: 196 ----GALVGVTSFGRGCG--RAPGVYAYITEEHLRWIK 227
                 | |. |.||||     ||||  ..   | ||.
Sbjct: 384 LQGRMTLTGIVSWGRGCALKDKPGVYTRVS-HFLPWIR 420

>hg18||uc001jwc
        |10|M15476|Q5SWW9|Q5SWW9_HUMAN|PLAU|NM_002658|NP_002649|urokinase
        plasminogen activator preproprotein

          Length = 431

 Score =  101 bits (250), Expect = 1e-021
 Identities = 67/218 (30%), Positives = 111/218 (50%), Gaps = 22/218 (10%)

Query:  31 TATGICGGTLINPKWVLTAAHC------EKVTTEALGVHSIRQKESWQV-FRVTHSIPYP 83
           . | .|||.||.| ||..| ||      ..     ||   .      .. | | . | . 
Sbjct: 204 SVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHK 263

Query:  84 AYNRKT--NDNDLMILKLET----AAKQTKNVKYLHLGSPKREPKTGTSCLTAGWGQTNE 137
            |.  |  . ||. .||. .     |. .. .. . | |   .|. ||||   |.|. | 
Sbjct: 264 DYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENS 323

Query: 138 AVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAGSK--NKDTCQGDSGGPLLCN 195
                 . |    | ..   || . .     .|  |.||       |.|||||||||.|.
Sbjct: 324 TDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCS 383

Query: 196 ----GALVGVTSFGRGCG--RAPGVYAYITEEHLRWIK 227
                 | |. |.||||     ||||  ..   | ||.
Sbjct: 384 LQGRMTLTGIVSWGRGCALKDKPGVYTRVS-HFLPWIR 420

>hg18||uc003mgo
        |5|NM_000505|P00748|FA12_HUMAN|F12|NM_000505|NP_000496|coagulation
        factor XII precursor

          Length = 615

 Score =  100 bits (248), Expect = 2e-021
 Identities = 73/229 (31%), Positives = 104/229 (45%), Gaps = 23/229 (10%)

Query:  10 SEIIGGKEVKPHSMPYMALVKTATGICGGTLINPKWVLTAAHC--EKVTTEALGVHSIRQ 67
           . ..||      . ||.| .      | |.|| | ||||||||  ..   | | |   ..
Sbjct: 371 TRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQE 430

Query:  68 K-----ESWQVFRVTHSIPYPAYNRKTNDNDLMILKLE-----TAAKQTKNVKYLHLGSP 117
           .     |  |   |     . |..  .  .|| .|.|.     . |  .  |. . | | 
Sbjct: 431 RRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSG 490

Query: 118 KREPKTGTSCLTAGWGQTNEAVKEISDVLMSVNVTVVDRMECSKYYSPNRVITKAMICAG 177
              |   | |  ||||   |  .| .  |    |  .    ||        |   |.|||
Sbjct: 491 AARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAG 550

Query: 178 --SKNKDTCQGDSGGPLLCNG-------ALVGVTSFGRGCG--RAPGVY 215
                 | |||||||||.|          | |. |.| |||    ||||
Sbjct: 551 FLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVY 599

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,969,116
Number of Sequences: 45480
Number of Extensions: 193969116
Number of Successful Extensions: 11336309
Number of sequences better than 0.0: 0
BLASTP 7.6.0