BLASTP 7.6.0


Query=fugu4_746868 |jgi|Takru4|746868|fgh5_pg.C_scaffold_4373000001
        (215 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003hcq |4|AF307080|Q9HAR2-2|Q9HAR2-2|LPHN3|NM_015236|NP_...     42   5e-004
hg18||uc003hcr |4|NM_015236|Q9HAR2-2|Q9HAR2-2|LPHN3|NM_015236|NP...     42   5e-004
hg18||uc001dis |1|AK123422|NA|NA|KIAA0786|NA|NA|Homo sapiens mRN...     40   0.001
hg18||uc001dit |1|AJ131581|Q5VX81|Q5VX81_HUMAN|LPHN2|NM_012302|N...     40   0.001
hg18||uc001diu |1|NM_012302|Q5VX81|Q5VX81_HUMAN|LPHN2|NM_012302|...     40   0.001
hg18||uc001div |1|AF104266|Q5VX83|Q5VX83_HUMAN|LPHN2|NA|NA|Latro...     40   0.001
hg18||uc002myg |19|NM_001008701|O94910|LPHN1_HUMAN|LPHN1|NM_0010...     37   0.021
hg18||uc002myh |19|NM_014921|O94910-2|O94910-2|LPHN1|NM_014921|N...     37   0.021
hg18||uc001rzc |12|NM_001013690|NA|NA|LOC401720|NM_001013690|NP_...     29   4.294

>hg18||uc003hcq
        |4|AF307080|Q9HAR2-2|Q9HAR2-2|LPHN3|NM_015236|NP_056051|latrophilin 3
        precursor

          Length = 1240

 Score =  42 bits (97), Expect = 5e-004
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 11/98 (11%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTPS--DYTFCTARGFGEDVKSM 177
           |  ..|.    .|.|    || |  .|||| |   |   |.  .   |      . .   
Sbjct:  31 RRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQR 90

Query: 178 CNGRKECSIPGNPKGRIVFLFCDESP---KYVYVSYVC 212
           || | .|..   |      .| |  |   ||. | | |
Sbjct:  91 CNNRTQCAVVAGPD-----VFPDPCPGTYKYLEVQYEC 123

>hg18||uc003hcr
        |4|NM_015236|Q9HAR2-2|Q9HAR2-2|LPHN3|NM_015236|NP_056051|latrophilin 3
        precursor

          Length = 1240

 Score =  42 bits (97), Expect = 5e-004
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 11/98 (11%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTPS--DYTFCTARGFGEDVKSM 177
           |  ..|.    .|.|    || |  .|||| |   |   |.  .   |      . .   
Sbjct:  31 RRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQR 90

Query: 178 CNGRKECSIPGNPKGRIVFLFCDESP---KYVYVSYVC 212
           || | .|..   |      .| |  |   ||. | | |
Sbjct:  91 CNNRTQCAVVAGPD-----VFPDPCPGTYKYLEVQYEC 123

>hg18||uc001dis |1|AK123422|NA|NA|KIAA0786|NA|NA|Homo sapiens mRNA for KIAA0786
        protein, partial cds

          Length = 383

 Score =  40 bits (93), Expect = 0.001
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  ..|.  . ||.|    || |  .|||| |   |   |   . | |      . .   
Sbjct:  37 RRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR 96

Query: 178 CNGRKECSIPGNPKGRIVFLF-CDESPKYVYVSYVC 212
           || | .| .     |  ||   |  . ||. | | |
Sbjct:  97 CNNRTQCIV---VTGSDVFPDPCPGTYKYLEVQYEC 129

>hg18||uc001dit
        |1|AJ131581|Q5VX81|Q5VX81_HUMAN|LPHN2|NM_012302|NP_036434|latrophilin 2
        precursor

          Length = 1403

 Score =  40 bits (93), Expect = 0.001
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  ..|.  . ||.|    || |  .|||| |   |   |   . | |      . .   
Sbjct:  37 RRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR 96

Query: 178 CNGRKECSIPGNPKGRIVFLF-CDESPKYVYVSYVC 212
           || | .| .     |  ||   |  . ||. | | |
Sbjct:  97 CNNRTQCIV---VTGSDVFPDPCPGTYKYLEVQYEC 129

>hg18||uc001diu
        |1|NM_012302|Q5VX81|Q5VX81_HUMAN|LPHN2|NM_012302|NP_036434|latrophilin
        2 precursor

          Length = 1403

 Score =  40 bits (93), Expect = 0.001
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  ..|.  . ||.|    || |  .|||| |   |   |   . | |      . .   
Sbjct:  37 RRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR 96

Query: 178 CNGRKECSIPGNPKGRIVFLF-CDESPKYVYVSYVC 212
           || | .| .     |  ||   |  . ||. | | |
Sbjct:  97 CNNRTQCIV---VTGSDVFPDPCPGTYKYLEVQYEC 129

>hg18||uc001div |1|AF104266|Q5VX83|Q5VX83_HUMAN|LPHN2|NA|NA|Latrophilin 2

          Length = 1177

 Score =  40 bits (93), Expect = 0.001
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 7/96 (7%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  ..|.  . ||.|    || |  .|||| |   |   |   . | |      . .   
Sbjct:  37 RRELSCEGYSIDLRCPGSDVIMIESANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQR 96

Query: 178 CNGRKECSIPGNPKGRIVFLF-CDESPKYVYVSYVC 212
           || | .| .     |  ||   |  . ||. | | |
Sbjct:  97 CNNRTQCIV---VTGSDVFPDPCPGTYKYLEVQYEC 129

>hg18||uc002myg
        |19|NM_001008701|O94910|LPHN1_HUMAN|LPHN1|NM_001008701|NP_001008701|lat
        rophilin 1 isoform 1 precursor

          Length = 1474

 Score =  37 bits (83), Expect = 0.021
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 11/98 (11%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  .||.    .|.|    || .  .|||| |   |   |   .   |      . .   
Sbjct:  36 RRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQR 95

Query: 178 CNGRKECSIPGNPKGRIVFLFCDESP---KYVYVSYVC 212
           || | .| .           | |  |   ||. | | |
Sbjct:  96 CNNRTQCVVVAGSDA-----FPDPCPGTYKYLEVQYDC 128

>hg18||uc002myh
        |19|NM_014921|O94910-2|O94910-2|LPHN1|NM_014921|NP_055736|latrophilin 1
        isoform 2 precursor

          Length = 1469

 Score =  37 bits (83), Expect = 0.021
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 11/98 (11%)

Query: 121 RTVIACKDQTADLKCE-KGVIRIIKSNYGRLDQNTCTDTP--SDYTFCTARGFGEDVKSM 177
           |  .||.    .|.|    || .  .|||| |   |   |   .   |      . .   
Sbjct:  36 RRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQR 95

Query: 178 CNGRKECSIPGNPKGRIVFLFCDESP---KYVYVSYVC 212
           || | .| .           | |  |   ||. | | |
Sbjct:  96 CNNRTQCVVVAGSDA-----FPDPCPGTYKYLEVQYDC 128

>hg18||uc001rzc
        |12|NM_001013690|NA|NA|LOC401720|NM_001013690|NP_001013712|hypothetical
        protein LOC401720

          Length = 653

 Score =  29 bits (63), Expect = 4.294
 Identities = 28/104 (26%), Positives = 39/104 (37%), Gaps = 6/104 (5%)

Query:   9 LTFLVACWCSGCQGQMMSMAPLGSNLMLSCPRGQEINIVSMVHSNKGFE-NNAQDFCSSI 67
           | | ||   |  .||..  |       ||     |  . ..|   .||        |   
Sbjct: 551 LRFYVALPDSPARGQILQRALAQQGCALS-----ERELAALVQGTQGFSGGELGQLCQQA 605

Query:  68 APSSCLHPMLMPCCDNLQECRLAKVDKRMLICDLDTFTAVSAFY 111
           |  . |  .  |      |  ||||  |    .||.|      |
Sbjct: 606 AAGAGLPGLQRPLSYKDLEAALAKVGPRASAKELDSFVEWDKMY 649

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0