BLASTP 7.6.0


Query=fugu4_746823 |jgi|Takru4|746823|fgh5_pg.C_scaffold_4279000001
        (228 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003ayn |22|NM_015088|Q9UPQ9|TNC6B_HUMAN|TNRC6B|NM_015088...     30   1.643
hg18||uc003ayo |22|BX647630|NA|NA|KIAA1093|NA|NA|Homo sapiens mR...     30   1.643
hg18||uc003vpj |7|NM_014997|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_0149...     29   4.779
hg18||uc003vpk |7|D87454|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|...     29   4.779
hg18||uc003vpj |7|NM_014997|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_0149...     28   6.242
hg18||uc003vpk |7|D87454|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|...     28   6.242

>hg18||uc003ayn
        |22|NM_015088|Q9UPQ9|TNC6B_HUMAN|TNRC6B|NM_015088|NP_055903|trinucleoti
        de repeat containing 6B isoform 1

          Length = 1722

 Score =  30 bits (67), Expect = 1.643
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query:  18 QGWGNDRA--QGWGNDRAQGWGHDRAQGWGNDRAQGWGNDRAQGW---GNDHAQGWGN 70
           ||||  |   ||| . .  ||| .  |   |   .   .    ||   | .    |||
Sbjct: 730 QGWGGGRQPNQGWSSGK-NGWGEEVDQ-TKNSNWESSASKPVSGWGEGGQNEIGTWGN 785

>hg18||uc003ayo |22|BX647630|NA|NA|KIAA1093|NA|NA|Homo sapiens mRNA for KIAA1093
        protein, partial cds

          Length = 1452

 Score =  30 bits (67), Expect = 1.643
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query:  18 QGWGNDRA--QGWGNDRAQGWGHDRAQGWGNDRAQGWGNDRAQGW---GNDHAQGWGN 70
           ||||  |   ||| . .  ||| .  |   |   .   .    ||   | .    |||
Sbjct: 534 QGWGGGRQPNQGWSSGK-NGWGEEVDQ-TKNSNWESSASKPVSGWGEGGQNEIGTWGN 589

>hg18||uc003vpj
        |7|NM_014997|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|NP_055812|hypotheti
        cal protein LOC23008

          Length = 442

 Score =  29 bits (63), Expect = 4.779
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 2/53 (3%)

Query: 17 AQGWGNDRAQGWGNDRAQGWGHDRAQGWGNDRAQGWG--NDRAQGWGNDHAQG 67
          ||||  .| .| |   | | |     | |    .| |  |   |  |  |  |
Sbjct:  4 AQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPG 56

>hg18||uc003vpk
        |7|D87454|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|NP_055812|hypothetical
        protein LOC23008

          Length = 413

 Score =  29 bits (63), Expect = 4.779
 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 2/53 (3%)

Query: 17 AQGWGNDRAQGWGNDRAQGWGHDRAQGWGNDRAQGWG--NDRAQGWGNDHAQG 67
          ||||  .| .| |   | | |     | |    .| |  |   |  |  |  |
Sbjct:  4 AQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPG 56

>hg18||uc003vpj
        |7|NM_014997|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|NP_055812|hypotheti
        cal protein LOC23008

          Length = 442

 Score =  28 bits (62), Expect = 6.242
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 33 AQGWGHDRAQGWGNDRAQGWGNDRAQGWGNDHAQGWG 69
          ||||  .| .| |   | | |.    | |    .| |
Sbjct:  4 AQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTG 40

>hg18||uc003vpk
        |7|D87454|Q6PID8|Q6PID8_HUMAN|KIAA0265|NM_014997|NP_055812|hypothetical
        protein LOC23008

          Length = 413

 Score =  28 bits (62), Expect = 6.242
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 33 AQGWGHDRAQGWGNDRAQGWGNDRAQGWGNDHAQGWG 69
          ||||  .| .| |   | | |.    | |    .| |
Sbjct:  4 AQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTG 40

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0