BLASTP 7.6.0


Query=fugu4_746724 |jgi|Takru4|746724|fgh5_pg.C_scaffold_4092000001
        (115 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc003gvu |4|NM_014988|Q9UPQ0|Q9UPQ0_HUMAN|DKFZP686A01247|N...     28   1.196
hg18||uc003gvv |4|CR933645|Q5H9S8|Q5H9S8_HUMAN|DKFZP686A01247|NM...     28   1.196
hg18||uc003gvw |4|CR936664|Q5H9S8|Q5H9S8_HUMAN|DKFZP686A01247|NM...     28   1.196
hg18||uc003gvx |4|CR936601|Q5CZB6|Q5CZB6_HUMAN|DKFZP686A01247|NM...     28   1.196
hg18||uc002dic |16|AK125952|NA|NA|DNAH3|NM_017539|NP_060009|dyne...     28   1.562
hg18||uc002did |16|NM_017539|Q8TD57|Q8TD57_HUMAN|DNAH3|NM_017539...     28   1.562
hg18||uc001gpm |1|NM_033345|NA|NA|RGS8|NM_033345|NP_203131|regul...     27   2.665
hg18||uc001gpn |1|BC103867|P57771|RGS8_HUMAN|RGS8|NM_033345|NP_2...     27   2.665
hg18||uc001prb |11|AB028975|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956...     26   7.755
hg18||uc001prc |11|NM_014956|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_01495...     26   7.755
hg18||uc001prg |11|BX647583|NA|NA|CEP164|NM_014956|NP_055771|cen...     26   7.755

>hg18||uc003gvu
        |4|NM_014988|Q9UPQ0|Q9UPQ0_HUMAN|DKFZP686A01247|NM_014988|NP_055803|hyp
        othetical protein LOC22998

          Length = 1083

 Score =  28 bits (62), Expect = 1.196
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query:  57 EELQQLPKKLKIDNQEIEATRMTVLDYSLTSPQVIDCWFTSVEDALRKPLH 107
           .| . |  ... |  .||. . .. |        |||| .   |.|  | |
Sbjct: 151 KEFEGLLAQMRKDTDDIESPKRSIRDSG-----YIDCWDSERSDSLSPPRH 196

>hg18||uc003gvv
        |4|CR933645|Q5H9S8|Q5H9S8_HUMAN|DKFZP686A01247|NM_014988|NP_055803|hypo
        thetical protein LOC22998

          Length = 1057

 Score =  28 bits (62), Expect = 1.196
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query:  57 EELQQLPKKLKIDNQEIEATRMTVLDYSLTSPQVIDCWFTSVEDALRKPLH 107
           .| . |  ... |  .||. . .. |        |||| .   |.|  | |
Sbjct: 151 KEFEGLLAQMRKDTDDIESPKRSIRDSG-----YIDCWDSERSDSLSPPRH 196

>hg18||uc003gvw
        |4|CR936664|Q5H9S8|Q5H9S8_HUMAN|DKFZP686A01247|NM_014988|NP_055803|hypo
        thetical protein LOC22998

          Length = 1056

 Score =  28 bits (62), Expect = 1.196
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query:  57 EELQQLPKKLKIDNQEIEATRMTVLDYSLTSPQVIDCWFTSVEDALRKPLH 107
           .| . |  ... |  .||. . .. |        |||| .   |.|  | |
Sbjct: 151 KEFEGLLAQMRKDTDDIESPKRSIRDSG-----YIDCWDSERSDSLSPPRH 196

>hg18||uc003gvx
        |4|CR936601|Q5CZB6|Q5CZB6_HUMAN|DKFZP686A01247|NM_014988|NP_055803|hypo
        thetical protein LOC22998

          Length = 1069

 Score =  28 bits (62), Expect = 1.196
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query:  57 EELQQLPKKLKIDNQEIEATRMTVLDYSLTSPQVIDCWFTSVEDALRKPLH 107
           .| . |  ... |  .||. . .. |        |||| .   |.|  | |
Sbjct: 151 KEFEGLLAQMRKDTDDIESPKRSIRDSG-----YIDCWDSERSDSLSPPRH 196

>hg18||uc002dic |16|AK125952|NA|NA|DNAH3|NM_017539|NP_060009|dynein, axonemal,
        heavy polypeptide 3

          Length = 1551

 Score =  28 bits (61), Expect = 1.562
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query:   29 KEFLWPVLRQRPSDSSVTEILALQPVVYEE 58
            .|    .| . | |  . |.. | ||||||
Sbjct: 1276 EELAQDILSKLPRDFDLEEVMKLYPVVYEE 1305

>hg18||uc002did
        |16|NM_017539|Q8TD57|Q8TD57_HUMAN|DNAH3|NM_017539|NP_060009|dynein,
        axonemal, heavy polypeptide 3

          Length = 4116

 Score =  28 bits (61), Expect = 1.562
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query:   29 KEFLWPVLRQRPSDSSVTEILALQPVVYEE 58
            .|    .| . | |  . |.. | ||||||
Sbjct: 3841 EELAQDILSKLPRDFDLEEVMKLYPVVYEE 3870

>hg18||uc001gpm |1|NM_033345|NA|NA|RGS8|NM_033345|NP_203131|regulator of
        G-protein signalling 8

          Length = 198

 Score =  27 bits (59), Expect = 2.665
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query:  27 EGKEFLWPVLRQRPSDSSVTEILALQPVVYEEL--QQLPKKLKIDNQEIEATRMTVLDYS 84
           |  || |    .     |  ....    ..||    | |... || |  ||||  . . |
Sbjct:  99 ENLEF-WLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPS 157

Query:  85 LT 86
           ||
Sbjct: 158 LT 159

>hg18||uc001gpn |1|BC103867|P57771|RGS8_HUMAN|RGS8|NM_033345|NP_203131|regulator
        of G-protein signalling 8

          Length = 180

 Score =  27 bits (59), Expect = 2.665
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query:  27 EGKEFLWPVLRQRPSDSSVTEILALQPVVYEEL--QQLPKKLKIDNQEIEATRMTVLDYS 84
           |  || |    .     |  ....    ..||    | |... || |  ||||  . . |
Sbjct:  81 ENLEF-WLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPS 139

Query:  85 LT 86
           ||
Sbjct: 140 LT 141

>hg18||uc001prb
        |11|AB028975|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956|NP_055771|centrosomal
        protein 164kDa

          Length = 1455

 Score =  26 bits (55), Expect = 7.755
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query:  24 HLLEGKEFLWPVLRQRPSDSSVTEILALQPVVYEELQQLPKKLKIDNQEIEA 75
           |||| |.     ||..       ||| |     . |  | ..|.   .| ||
Sbjct: 612 HLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEEEA 663

>hg18||uc001prc
        |11|NM_014956|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956|NP_055771|centrosoma
        l protein 164kDa

          Length = 1460

 Score =  26 bits (55), Expect = 7.755
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query:  24 HLLEGKEFLWPVLRQRPSDSSVTEILALQPVVYEELQQLPKKLKIDNQEIEA 75
           |||| |.     ||..       ||| |     . |  | ..|.   .| ||
Sbjct: 609 HLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEEEA 660

>hg18||uc001prg |11|BX647583|NA|NA|CEP164|NM_014956|NP_055771|centrosomal
        protein 164kDa

          Length = 844

 Score =  26 bits (55), Expect = 7.755
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 24 HLLEGKEFLWPVLRQRPSDSSVTEILALQPVVYEELQQLPKKLKIDNQEIEA 75
          |||| |.     ||..       ||| |     . |  | ..|.   .| ||
Sbjct: 42 HLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEEEA 93

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 193,842,887
Number of Sequences: 45480
Number of Extensions: 193842887
Number of Successful Extensions: 11488998
Number of sequences better than 0.0: 0
BLASTP 7.6.0