BLASTP 7.6.0


Query=fugu4_746571 |jgi|Takru4|746571|fgh5_pg.C_scaffold_3855000003
        (187 letters)

Database: hg18;
          45,480 sequences; 22,939,511 total letters
                                                                  Score    E

hg18||uc002prq |19|NM_001077186|Q7Z406-2|Q7Z406-2|MYH14|NM_00107...     37   0.016
hg18||uc002prr |19|NM_024729|Q7Z406-2|Q7Z406-2|MYH14|NM_024729|N...     37   0.016
hg18||uc001qiz |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP...     35   0.047
hg18||uc001qjb |12|NM_178040|Q8IUD2|RB6I2_HUMAN|ERC1|NM_178040|N...     35   0.047
hg18||uc001qjc |12|NM_178039|Q8IUD2-3|Q8IUD2-3|ERC1|NM_178039|NP...     35   0.047
hg18||uc001qjd |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP...     35   0.047
hg18||uc001prb |11|AB028975|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956...     33   0.231
hg18||uc001prc |11|NM_014956|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_01495...     33   0.231
hg18||uc001prg |11|BX647583|NA|NA|CEP164|NM_014956|NP_055771|cen...     33   0.231
hg18||uc002jfl |17|NM_145036|Q8N8E3|CCD46_HUMAN|CCDC46|NM_145036...     31   0.673
hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP...     31   0.879
hg18||uc002rte |2|BC063310|Q6P4Q1|Q6P4Q1_HUMAN|PLEKHH2|NA|NA|PLE...     30   1.148
hg18||uc002rtf |2|AK126308|NA|NA|PLEKHH2|NM_172069|NP_742066|ple...     30   1.148
hg18||uc002rtg |2|NM_172069|Q8IVE3|Q8IVE3_HUMAN|PLEKHH2|NM_17206...     30   1.148
hg18||uc001ogy |11|NM_006842|Q9BWD2|Q9BWD2_HUMAN|SF3B2|NM_006842...     30   1.499
hg18||uc002xcm |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186...     30   1.499
hg18||uc002xcn |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_0010...     30   1.499
hg18||uc003ncf |6|AJ291579|Q9H1H9-3|Q9H1H9-3|KIF13A|NM_022113|NP...     29   2.557
hg18||uc003ncg |6|NM_022113|Q9H1H9|KI13A_HUMAN|KIF13A|NM_022113|...     29   2.557
hg18||uc003nch |6|BC127115|Q9H1H9-2|Q9H1H9-2|KIF13A|NM_022113|NP...     29   2.557
hg18||uc003nci |6|BC127116|Q9H1H9-4|Q9H1H9-4|KIF13A|NM_022113|NP...     29   2.557
hg18||uc003ncj |6|BC023613|NA|NA|KIN13A|NA|NA|Homo sapiens mRNA ...     29   2.557
hg18||uc003xhh |8|NM_015254|Q9NQT8|KI13B_HUMAN|KIF13B|NM_015254|...     29   2.557
hg18||uc003xhj |8|BC051859|NA|NA|KIAA0639|NA|NA|Homo sapiens mRN...     29   2.557
hg18||uc001txh |12|AB023166|O14578-3|O14578-3|CIT|NM_007174|NP_0...     28   5.696
hg18||uc001txi |12|NM_007174|O14578|CTRO_HUMAN|CIT|NM_007174|NP_...     28   5.696
hg18||uc001txj |12|AY681966|Q2M5E1|Q2M5E1_HUMAN|CIT|NM_007174|NP...     28   5.696
hg18||uc002iqh |17|NM_032595|NA|NA|PPP1R9B|NM_032595|NP_115984|p...     28   5.696
hg18||uc003qgz |6|NM_003980|Q14244|MAP7_HUMAN|MAP7|NM_003980|NP_...     28   5.696
hg18||uc003qha |6|AJ242502|Q14244-2|Q14244-2|MAP7|NM_003980|NP_0...     28   5.696

>hg18||uc002prq
        |19|NM_001077186|Q7Z406-2|Q7Z406-2|MYH14|NM_001077186|NP_001070654|myos
        in, heavy chain 14 isoform 1

          Length = 2003

 Score =  37 bits (83), Expect = 0.016
 Identities = 20/70 (28%), Positives = 34/70 (48%)

Query:    3 QRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQL 62
            ... ..|  .   |   |   ..  ..||  |  |||.|  |. |      |  . |  |
Sbjct: 1079 EKLKRRLDGESSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSL 1138

Query:   63 NSTQAALKES 72
               |||| |.
Sbjct: 1139 REAQAALAEA 1148

>hg18||uc002prr
        |19|NM_024729|Q7Z406-2|Q7Z406-2|MYH14|NM_024729|NP_079005|myosin, heavy
        chain 14 isoform 2

          Length = 1995

 Score =  37 bits (83), Expect = 0.016
 Identities = 20/70 (28%), Positives = 34/70 (48%)

Query:    3 QRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQL 62
            ... ..|  .   |   |   ..  ..||  |  |||.|  |. |      |  . |  |
Sbjct: 1071 EKLKRRLDGESSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSL 1130

Query:   63 NSTQAALKES 72
               |||| |.
Sbjct: 1131 REAQAALAEA 1140

>hg18||uc001qiz
        |12|NM_178037|Q8IUD2-2|Q8IUD2-2|ERC1|NM_178037|NP_829881|RAB6-interacti
        ng protein 2 isoform beta

          Length = 992

 Score =  35 bits (79), Expect = 0.047
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLS--RAVKRRHMRTVADVETL 59
           |..  ..|    | .   .|. . ..   ...|||||  |.  || .|.|.  | ...  
Sbjct: 846 AEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQE 905

Query:  60 TQLNSTQAALKESNLKCASLE 80
             |    ||. | .   | ||
Sbjct: 906 ALL----AAISEKDANIALLE 922

>hg18||uc001qjb
        |12|NM_178040|Q8IUD2|RB6I2_HUMAN|ERC1|NM_178040|NP_829884|RAB6-interact
        ing protein 2 isoform epsilon

          Length = 1116

 Score =  35 bits (79), Expect = 0.047
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLS--RAVKRRHMRTVADVETL 59
           |..  ..|    | .   .|. . ..   ...|||||  |.  || .|.|.  | ...  
Sbjct: 870 AEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQE 929

Query:  60 TQLNSTQAALKESNLKCASLE 80
             |    ||. | .   | ||
Sbjct: 930 ALL----AAISEKDANIALLE 946

>hg18||uc001qjc
        |12|NM_178039|Q8IUD2-3|Q8IUD2-3|ERC1|NM_178039|NP_829883|RAB6-interacti
        ng protein 2 isoform delta

          Length = 1088

 Score =  35 bits (79), Expect = 0.047
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLS--RAVKRRHMRTVADVETL 59
           |..  ..|    | .   .|. . ..   ...|||||  |.  || .|.|.  | ...  
Sbjct: 842 AEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQE 901

Query:  60 TQLNSTQAALKESNLKCASLE 80
             |    ||. | .   | ||
Sbjct: 902 ALL----AAISEKDANIALLE 918

>hg18||uc001qjd
        |12|NM_178038|Q8IUD2-5|Q8IUD2-5|ERC1|NM_178038|NP_829882|RAB6-interacti
        ng protein 2 isoform gamma

          Length = 720

 Score =  35 bits (79), Expect = 0.047
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLS--RAVKRRHMRTVADVETL 59
           |..  ..|    | .   .|. . ..   ...|||||  |.  || .|.|.  | ...  
Sbjct: 574 AEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQE 633

Query:  60 TQLNSTQAALKESNLKCASLE 80
             |    ||. | .   | ||
Sbjct: 634 ALL----AAISEKDANIALLE 650

>hg18||uc001prb
        |11|AB028975|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956|NP_055771|centrosomal
        protein 164kDa

          Length = 1455

 Score =  33 bits (73), Expect = 0.231
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query:   1 MAQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT 60
           | . | | |. ||  |   .|. .|..||||| | ..||.    . | | .    . .| 
Sbjct: 598 MEEAVAQVLEQDQRHL---LESKQEKMQQLREKLCQEEEE---EILRLHQQKEQSLSSLR 651

Query:  61 QLNSTQAALKESNLK 75
           .    | |..|   .
Sbjct: 652 E--RLQKAIEEEEAR 664

>hg18||uc001prc
        |11|NM_014956|Q9UPV0|Q9UPV0_HUMAN|CEP164|NM_014956|NP_055771|centrosoma
        l protein 164kDa

          Length = 1460

 Score =  33 bits (73), Expect = 0.231
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query:   1 MAQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT 60
           | . | | |. ||  |   .|. .|..||||| | ..||.    . | | .    . .| 
Sbjct: 595 MEEAVAQVLEQDQRHL---LESKQEKMQQLREKLCQEEEE---EILRLHQQKEQSLSSLR 648

Query:  61 QLNSTQAALKESNLK 75
           .    | |..|   .
Sbjct: 649 E--RLQKAIEEEEAR 661

>hg18||uc001prg |11|BX647583|NA|NA|CEP164|NM_014956|NP_055771|centrosomal
        protein 164kDa

          Length = 844

 Score =  33 bits (73), Expect = 0.231
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query:  1 MAQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT 60
          | . | | |. ||  |   .|. .|..||||| | ..||.    . | | .    . .| 
Sbjct: 28 MEEAVAQVLEQDQRHL---LESKQEKMQQLREKLCQEEEE---EILRLHQQKEQSLSSLR 81

Query: 61 QLNSTQAALKESNLK 75
          .    | |..|   .
Sbjct: 82 E--RLQKAIEEEEAR 94

>hg18||uc002jfl
        |17|NM_145036|Q8N8E3|CCD46_HUMAN|CCDC46|NM_145036|NP_659473|coiled-coil
        domain containing 46 isoform a

          Length = 955

 Score =  31 bits (69), Expect = 0.673
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query:  13 QEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMR 51
           |  ||   |  .... .  ||| ||||||.|  . . ..
Sbjct: 557 QSELDKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQ 595

>hg18||uc001grv |1|NM_003292|Q99968|Q99968_HUMAN|TPR|NM_003292|NP_003283|nuclear
        pore complex-associated protein TPR

          Length = 2363

 Score =  31 bits (68), Expect = 0.879
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 10/76 (13%)

Query:    3 QRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAV-----KRRHMRTVADVE 57
            |  | ||...   |   ..    . .|||. . ||||.  .|.     |  |.  | |  
Sbjct: 1515 QEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAAKSKIAHLAGVKD-- 1572

Query:   58 TLTQLNSTQAALKESN 73
               ||      ||. |
Sbjct: 1573 ---QLTKENEELKQRN 1585

>hg18||uc002rte |2|BC063310|Q6P4Q1|Q6P4Q1_HUMAN|PLEKHH2|NA|NA|PLEKHH2 protein

          Length = 796

 Score =  30 bits (67), Expect = 1.148
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 16 LDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQLNSTQAALKESNLK 75
          |.| .  .| .  ..|| |||| .|| | |     .     .   |.   .  || .|..
Sbjct: 20 LESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQA---EKAFQQVQVMEDKLKAANIQ 76

Query: 76 CASLEETLHS 85
           .  |  |..
Sbjct: 77 TSESETRLYN 86

>hg18||uc002rtf |2|AK126308|NA|NA|PLEKHH2|NM_172069|NP_742066|pleckstrin
        homology domain containing, family H

          Length = 1077

 Score =  30 bits (67), Expect = 1.148
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 16 LDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQLNSTQAALKESNLK 75
          |.| .  .| .  ..|| |||| .|| | |     .     .   |.   .  || .|..
Sbjct: 20 LESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQA---EKAFQQVQVMEDKLKAANIQ 76

Query: 76 CASLEETLHS 85
           .  |  |..
Sbjct: 77 TSESETRLYN 86

>hg18||uc002rtg
        |2|NM_172069|Q8IVE3|Q8IVE3_HUMAN|PLEKHH2|NM_172069|NP_742066|pleckstrin
        homology domain containing, family H

          Length = 1493

 Score =  30 bits (67), Expect = 1.148
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 16 LDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQLNSTQAALKESNLK 75
          |.| .  .| .  ..|| |||| .|| | |     .     .   |.   .  || .|..
Sbjct: 20 LESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQA---EKAFQQVQVMEDKLKAANIQ 76

Query: 76 CASLEETLHS 85
           .  |  |..
Sbjct: 77 TSESETRLYN 86

>hg18||uc001ogy
        |11|NM_006842|Q9BWD2|Q9BWD2_HUMAN|SF3B2|NM_006842|NP_006833|splicing
        factor 3B subunit 2

          Length = 895

 Score =  30 bits (66), Expect = 1.499
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query:  12 DQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRR 48
           .. | . |    |  .|..|||| ||||| .   | |
Sbjct: 518 EKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMR 554

>hg18||uc002xcm
        |20|NM_007186|Q9BV73|CP250_HUMAN|CEP250|NM_007186|NP_009117|centrosomal
        protein 2 isoform 1

          Length = 2442

 Score =  30 bits (66), Expect = 1.499
 Identities = 12/49 (24%), Positives = 31/49 (63%)

Query:    2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHM 50
            .... . |.  .  .      ..|.||||..|||...|.|    .|  .
Sbjct: 2012 SRQLEEALRIQEGEIQDQDLRYQEDVQQLQQALAQRDEELRHQQEREQL 2060

>hg18||uc002xcn
        |20|NM_001035518|Q9BV73-2|Q9BV73-2|CEP250|NM_001035518|NP_001030595|cen
        trosomal protein 2 isoform 2

          Length = 2386

 Score =  30 bits (66), Expect = 1.499
 Identities = 12/49 (24%), Positives = 31/49 (63%)

Query:    2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHM 50
            .... . |.  .  .      ..|.||||..|||...|.|    .|  .
Sbjct: 1956 SRQLEEALRIQEGEIQDQDLRYQEDVQQLQQALAQRDEELRHQQEREQL 2004

>hg18||uc003ncf |6|AJ291579|Q9H1H9-3|Q9H1H9-3|KIF13A|NM_022113|NP_071396|kinesin
        family member 13A

          Length = 1749

 Score =  29 bits (64), Expect = 2.557
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |.|.      ...|    .   ||||..||| |.. |   .  .| .   .   .. || 
Sbjct: 349 AKRIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTV 408

Query:  61 ----QLNSTQAALKESNLKCASL 79
               .|  |.   .|   .  |.
Sbjct: 409 TWEEKLRKTEEIAQERQRQLESM 431

>hg18||uc003ncg
        |6|NM_022113|Q9H1H9|KI13A_HUMAN|KIF13A|NM_022113|NP_071396|kinesin
        family member 13A

          Length = 1805

 Score =  29 bits (64), Expect = 2.557
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |.|.      ...|    .   ||||..||| |.. |   .  .| .   .   .. || 
Sbjct: 349 AKRIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTV 408

Query:  61 ----QLNSTQAALKESNLKCASL 79
               .|  |.   .|   .  |.
Sbjct: 409 TWEEKLRKTEEIAQERQRQLESM 431

>hg18||uc003nch |6|BC127115|Q9H1H9-2|Q9H1H9-2|KIF13A|NM_022113|NP_071396|kinesin
        family member 13A

          Length = 1770

 Score =  29 bits (64), Expect = 2.557
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |.|.      ...|    .   ||||..||| |.. |   .  .| .   .   .. || 
Sbjct: 349 AKRIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTV 408

Query:  61 ----QLNSTQAALKESNLKCASL 79
               .|  |.   .|   .  |.
Sbjct: 409 TWEEKLRKTEEIAQERQRQLESM 431

>hg18||uc003nci |6|BC127116|Q9H1H9-4|Q9H1H9-4|KIF13A|NM_022113|NP_071396|kinesin
        family member 13A

          Length = 1757

 Score =  29 bits (64), Expect = 2.557
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |.|.      ...|    .   ||||..||| |.. |   .  .| .   .   .. || 
Sbjct: 349 AKRIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTV 408

Query:  61 ----QLNSTQAALKESNLKCASL 79
               .|  |.   .|   .  |.
Sbjct: 409 TWEEKLRKTEEIAQERQRQLESM 431

>hg18||uc003ncj |6|BC023613|NA|NA|KIN13A|NA|NA|Homo sapiens mRNA for
        KINESIN-13A1 (KIN13A gene)

          Length = 360

 Score =  29 bits (64), Expect = 2.557
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |.|.      ...|    .   ||||..||| |.. |   .  .| .   .   .. || 
Sbjct:  25 AKRIVNHAVVNEDPNAKVIRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELTV 84

Query:  61 ----QLNSTQAALKESNLKCASL 79
               .|  |.   .|   .  |.
Sbjct:  85 TWEEKLRKTEEIAQERQRQLESM 107

>hg18||uc003xhh
        |8|NM_015254|Q9NQT8|KI13B_HUMAN|KIF13B|NM_015254|NP_056069|kinesin
        family member 13B

          Length = 1826

 Score =  29 bits (64), Expect = 2.557
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |. .      ...|    .   ||||..||| | . |   |  .| |   .   .. .| 
Sbjct: 350 AKHIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTV 409

Query:  61 ----QLNSTQAALKESNLKCASLEETLHS 85
               .|  |.   .|   .  ||  .| |
Sbjct: 410 TWEEKLRKTEEIAQERQKQLESLGISLQS 438

>hg18||uc003xhj |8|BC051859|NA|NA|KIAA0639|NA|NA|Homo sapiens mRNA for KIAA0639
        protein, partial cds

          Length = 640

 Score =  29 bits (64), Expect = 2.557
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query:   2 AQRVTQQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLT- 60
           |. .      ...|    .   ||||..||| | . |   |  .| |   .   .. .| 
Sbjct: 247 AKHIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTV 306

Query:  61 ----QLNSTQAALKESNLKCASLEETLHS 85
               .|  |.   .|   .  ||  .| |
Sbjct: 307 TWEEKLRKTEEIAQERQKQLESLGISLQS 335

>hg18||uc001txh |12|AB023166|O14578-3|O14578-3|CIT|NM_007174|NP_009105|citron

          Length = 1545

 Score =  28 bits (61), Expect = 5.696
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query:   7 QQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKR----RHMRTVADVETLTQL 62
           .| .| .  |      .   |..|.  |  ...  .|| .|    | .  .|  |   ..
Sbjct: 575 RQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKAEI 634

Query:  63 NSTQAALKESNLKCASLEETLH 84
            . | ||||  ||  || . |.
Sbjct: 635 LALQQALKEQKLKAESLSDKLN 656

>hg18||uc001txi |12|NM_007174|O14578|CTRO_HUMAN|CIT|NM_007174|NP_009105|citron

          Length = 2027

 Score =  28 bits (61), Expect = 5.696
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query:    7 QQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKR----RHMRTVADVETLTQL 62
            .| .| .  |      .   |..|.  |  ...  .|| .|    | .  .|  |   ..
Sbjct: 1041 RQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKAEI 1100

Query:   63 NSTQAALKESNLKCASLEETLH 84
             . | ||||  ||  || . |.
Sbjct: 1101 LALQQALKEQKLKAESLSDKLN 1122

>hg18||uc001txj |12|AY681966|Q2M5E1|Q2M5E1_HUMAN|CIT|NM_007174|NP_009105|citron

          Length = 2069

 Score =  28 bits (61), Expect = 5.696
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query:    7 QQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKR----RHMRTVADVETLTQL 62
            .| .| .  |      .   |..|.  |  ...  .|| .|    | .  .|  |   ..
Sbjct: 1083 RQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKAEI 1142

Query:   63 NSTQAALKESNLKCASLEETLH 84
             . | ||||  ||  || . |.
Sbjct: 1143 LALQQALKEQKLKAESLSDKLN 1164

>hg18||uc002iqh |17|NM_032595|NA|NA|PPP1R9B|NM_032595|NP_115984|protein
        phosphatase 1, regulatory subunit 9B

          Length = 815

 Score =  28 bits (61), Expect = 5.696
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query:   7 QQLKADQEPLDSPMETWREEVQQLREALAEKEEQLSR 43
           ||||   . |.     || |  || ... | .|.. .
Sbjct: 684 QQLKRKLQSLEQEKGRWRVEKAQLEQSVEENKERMEK 720

>hg18||uc003qgz
        |6|NM_003980|Q14244|MAP7_HUMAN|MAP7|NM_003980|NP_003971|microtubule-ass
        ociated protein 7

          Length = 749

 Score =  28 bits (61), Expect = 5.696
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query:   8 QLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQLNSTQA 67
           |  |..       |. | | .| |    |||||| |  . | .|   . |   .    .|
Sbjct: 517 QRVAEERTTRREEESRRLEAEQAR----EKEEQLQRQAEERALREREEAERAQRQKEEEA 572

Query:  68 ALKE 71
            ..|
Sbjct: 573 RVRE 576

>hg18||uc003qha
        |6|AJ242502|Q14244-2|Q14244-2|MAP7|NM_003980|NP_003971|microtubule-asso
        ciated protein 7

          Length = 709

 Score =  28 bits (61), Expect = 5.696
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query:   8 QLKADQEPLDSPMETWREEVQQLREALAEKEEQLSRAVKRRHMRTVADVETLTQLNSTQA 67
           |  |..       |. | | .| |    |||||| |  . | .|   . |   .    .|
Sbjct: 480 QRVAEERTTRREEESRRLEAEQAR----EKEEQLQRQAEERALREREEAERAQRQKEEEA 535

Query:  68 ALKE 71
            ..|
Sbjct: 536 RVRE 539

 
    Posted date:  Mon Jul 30 19:38:39 2007
  Number of letters in database: 22,939,511
  Number of sequences in database:  45,480

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 191,654,518
Number of Sequences: 45480
Number of Extensions: 191654518
Number of Successful Extensions: 10949811
Number of sequences better than 0.0: 0
BLASTP 7.6.0